KEGG   Bacillus subtilis subsp. subtilis 168: BSU06410
Entry
BSU06410          CDS       T00010                                 

Symbol
yebG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: NETI
Other DBs
NCBI-GeneID: 939351
NCBI-ProteinID: NP_388523
Pasteur: BG12816
BSORF: BG12816
UniProt: O34700 A0A6M4JDY5
Position
698092..698289
AA seq 65 aa
MAKPKKKKFEVTEQQTIDAVLQQMKEEGYLPVRRMEEPIFMEKKENGSIQIVPCGKKIVF
EGKLI
NT seq 198 nt   +upstreamnt  +downstreamnt
atggcaaagccgaagaagaaaaagtttgaagtgacagagcagcaaacgattgatgcggtg
cttcagcaaatgaaagaagaaggatatctgcctgtaaggcgaatggaagagcctattttt
atggaaaaaaaggaaaatgggtcaattcagatcgttccgtgcgggaaaaaaatcgtattt
gaagggaaattgatctaa

DBGET integrated database retrieval system