KEGG   Bacillus subtilis subsp. subtilis 168: BSU06420
Entry
BSU06420          CDS       T00010                                 

Symbol
purE
Name
(RefSeq) 5-(carboxyamino)imidazole ribonucleotide mutase
  KO
K01588  5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU06420 (purE)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.18  5-(carboxyamino)imidazole ribonucleotide mutase
     BSU06420 (purE)
SSDB
Motif
Pfam: AIRC
Other DBs
NCBI-GeneID: 939481
NCBI-ProteinID: NP_388524
Pasteur: BG10700
BSORF: BG10700
UniProt: P12044 A0A6M4JKS5
Position
698612..699100
AA seq 162 aa
MQPLVGIIMGSTSDWETMKHACDILDELNVPYEKKVVSAHRTPDFMFEYAETARERGIKV
IIAGAGGAAHLPGMTAAKTTLPVIGVPVQSKALNGMDSLLSIVQMPGGVPVATTSIGKAG
AVNAGLLAAQILSAFDEDLARKLDERRENTKQTVLESSDQLV
NT seq 489 nt   +upstreamnt  +downstreamnt
atgcagccgctagtaggaatcatcatgggaagcacttccgattgggagacaatgaaacac
gcatgcgacatacttgacgaactcaatgttccgtacgaaaaaaaggtcgtttccgctcac
cggacgcctgatttcatgtttgaatatgctgaaactgctagagaaagaggcatcaaggtg
attattgccggtgccggaggagcggcgcatctgccagggatgacggctgcgaaaacaaca
ctgccagtcattggagttccggttcagtccaaggcgctgaacggaatggattcacttctt
tccatcgtccaaatgcctggaggcgtgcctgttgcgacaacatccatcggcaaagcgggt
gctgtgaacgcaggcctgttagcggcgcaaattttgtcagcatttgacgaagaccttgcc
cgtaagctggatgagagaagagaaaatacaaaacagacagtgttagaaagcagtgatcag
cttgtctaa

DBGET integrated database retrieval system