KEGG   Bacillus subtilis subsp. subtilis 168: BSU06440
Entry
BSU06440          CDS       T00010                                 

Symbol
purB
Name
(RefSeq) adenylosuccinate lyase
  KO
K01756  adenylosuccinate lyase [EC:4.3.2.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00250  Alanine, aspartate and glutamate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
bsu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU06440 (purB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU06440 (purB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     BSU06440 (purB)
SSDB
Motif
Pfam: Lyase_1 ADSL_C
Other DBs
NCBI-GeneID: 936048
NCBI-ProteinID: NP_388526
Pasteur: BG10702
BSORF: BG10702
UniProt: P12047 A0A6M3ZBB6
Structure
PDB: 
1F1O

Position
700232..701527
AA seq 431 aa
MIERYSRPEMSAIWTDENRFQAWLEVEILACEAWAELGVIPKEDVKVMRENASFDINRIL
EIEKDTRHDVVAFTRAVSESLGEERKWVHYGLTSTDVVDTALSYLLKQANDILLKDLERF
VDIIKEKAKEHKYTVMMGRTHGVHAEPTTFGLKLALWHEEMKRNLERFKQAKAGIEVGKI
SGAVGTYANIDPFVEQYVCEKLGLKAAPISTQTLQRDRHADYMATLALIATSIEKFAVEI
RGLQKSETREVEEFFAKGQKGSSAMPHKRNPIGSENMTGMARVIRGYMMTAYENVPLWHE
RDISHSSAERIILPDATIALNYMLNRFSNIVKNLTVFPENMKRNMDRTLGLIYSQRVLLA
LIDTGLTREEAYDTVQPKAMEAWEKQVPFRELVEAEEKITSRLSPEKIADCFDYNYHLKN
VDLIFERLGLA
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgatcgaacgttattcaagacctgaaatgtccgcgatttggacggatgaaaacagattt
caagcatggttagaggttgaaattcttgcctgtgaagcgtgggcggagcttggcgtcatt
ccgaaagaagatgtaaaggttatgcgcgaaaacgcgtcatttgacatcaaccgcatttta
gaaatcgaaaaggacacgcgccatgacgttgtcgcttttacgcgcgctgtatccgaatca
ctgggcgaagaaagaaaatgggtgcattacggcttaacgtcaactgacgttgttgatacg
gctctttcctacttattaaaacaggcaaacgatattttgctcaaggatcttgagagattt
gttgacattataaaagaaaaagcgaaagaacataaatacacagtcatgatggggcgcaca
cacggcgtacacgctgagcctacaacattcggcttaaaacttgcgctttggcatgaagaa
atgaaacgtaatcttgagcgcttcaaacaagcgaaagcaggcatcgaggttggaaagatt
tccggtgctgtcggcacatatgcgaacattgatccatttgttgaacaatatgtctgtgag
aagctcggattgaaagcagcaccgatttccactcaaacccttcagcgtgaccgccatgct
gactatatggcaacacttgctttgatcgcgacaagcatcgagaaattcgctgtggaaatc
cgcggactgcaaaagagtgaaacacgtgaagtagaggaatttttcgcgaaagggcaaaag
ggttcatctgcaatgccgcataaacgaaatccgattggctctgaaaacatgacaggcatg
gcgcgcgtgatccgcggctacatgatgacagcttacgaaaatgttccattatggcatgag
cgcgatatttctcattcttcagcagaacgaattattcttccggatgcgacaattgcgctg
aactacatgctgaaccgcttctccaacatcgtgaagaacttaacggtcttcccggaaaac
atgaagcgcaacatggaccgcactctcggccttatctattctcagcgtgtgctccttgct
ttgattgacacaggcctgactcgtgaagaagcctatgatacagttcagccgaaagcaatg
gaagcgtgggaaaaacaagtgccgttccgcgagcttgtggaagcggaagagaaaatcacg
tcacgtctttctccagaaaaaattgctgactgctttgattacaattaccatctgaaaaat
gttgatctgatctttgaacgtttaggtttagcatag

DBGET integrated database retrieval system