KEGG   Bacillus subtilis subsp. subtilis 168: BSU06450Help
Entry
BSU06450          CDS       T00010                                 

Gene name
purC
Definition
(RefSeq) phosphoribosylaminoimidazole-succinocarboxamide synthase
  KO
K01923  phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
Module
bsu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU06450 (purC)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     BSU06450 (purC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SAICAR_synt
Motif
Other DBs
NCBI-GeneID: 939389
NCBI-ProteinID: NP_388527
Pasteur: BG10703
BSORF: BG10703
UniProt: P12046
Position
701601..702326
Genome map
AA seq 241 aa AA seqDB search
MNIVKNELLYEGKAKKIYKTDDENTLYVVYKDSATAFNGEKKAEISGKGRLNNEISSLIF
KHLHAKGINNHFIERISETEQLIKKVTIVPLEVVVRNVVAGSMSKRLGIPEGTELEQPII
EFYYKDDALGDPLITEDHIWLLKAATPEQVETIKSITTIVNEELQSIFDDCHVRLIDFKL
EFGLDAEGQVLLADEISPDTCRLWDKETNEKLDKDLFRRNLGSLTDAYEEIFNRLGGIHH
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgaatattgtgaagaatgaacttttatacgaaggaaaagcaaaaaagatctacaaaacc
gatgacgaaaacacgctgtatgtcgtgtataaagactccgccactgcctttaacggcgag
aaaaaagcagaaatcagcggaaaagggcgcttaaataatgaaatttcaagcctcattttc
aaacaccttcatgctaagggcattaacaatcattttatcgagcgcatttcggaaacggag
cagctcattaaaaaggtaacgattgtgccgcttgaagtcgtggtaagaaatgttgtggca
ggaagcatgtccaaacgtctcggcattccagaaggcacggagcttgagcagccgattatc
gagttttactacaaggatgacgcgctgggtgatccgctcatcacagaagatcatatttgg
cttttgaaggcggcgactcctgagcaggtagaaaccattaagtccattacaacaatagta
aatgaagagcttcaaagcatcttcgacgattgtcatgtcagattaatagatttcaagctt
gaattcggtttagatgcagaagggcaagtgcttttggcggatgaaatatctcctgacaca
tgccgcttgtgggataaagaaacgaacgaaaagctggacaaagatttattcagacgcaat
ctgggaagcttaaccgacgcatacgaagagattttcaatagactgggaggcattcatcat
gtataa

DBGET integrated database retrieval system