KEGG   Bacillus subtilis subsp. subtilis 168: BSU06460
Entry
BSU06460          CDS       T00010                                 

Symbol
purS
Name
(RefSeq) hypothetical protein
  KO
K23264  phosphoribosylformylglycinamidine synthase subunit PurS [EC:6.3.5.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU06460 (purS)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     BSU06460 (purS)
SSDB
Motif
Pfam: PurS DUF3333 WcbI
Other DBs
NCBI-GeneID: 936041
NCBI-ProteinID: NP_388528
Pasteur: BG10704
BSORF: BG10704
UniProt: P12049 A0A6M3ZDD8
Structure
PDB: 
1T4A 1TWJ

Position
702319..702573
AA seq 84 aa
MYKVKVYVSLKESVLDPQGSAVQHALHSMTYNEVQDVRIGKYMELTIEKSDRDLDVLVKE
MCEKLLANTVIEDYRYEVEEVVAQ
NT seq 255 nt   +upstreamnt  +downstreamnt
atgtataaagtaaaagtttatgtcagcttaaaagaaagtgtactagatccacaagggagc
gctgtccagcatgccttgcacagtatgacttacaacgaagttcaagatgtgcgcatcggg
aaatacatggagcttaccattgaaaaatctgaccgtgatcttgacgtgctagtgaaagaa
atgtgcgaaaaacttcttgcgaacacagtgattgaagattatagatatgaggttgaggag
gtagtcgcacagtga

DBGET integrated database retrieval system