KEGG   Bacillus subtilis subsp. subtilis 168: BSU06470
Entry
BSU06470          CDS       T00010                                 

Symbol
purQ
Name
(RefSeq) phosphoribosylformylglycinamidine synthase
  KO
K23265  phosphoribosylformylglycinamidine synthase subunit PurQ / glutaminase [EC:6.3.5.3 3.5.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00220  Arginine biosynthesis
bsu00230  Purine metabolism
bsu00250  Alanine, aspartate and glutamate metabolism
bsu00470  D-Amino acid metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU06470 (purQ)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU06470 (purQ)
   00220 Arginine biosynthesis
    BSU06470 (purQ)
  09106 Metabolism of other amino acids
   00470 D-Amino acid metabolism
    BSU06470 (purQ)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BSU06470 (purQ)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     BSU06470 (purQ)
SSDB
Motif
Pfam: GATase_5 GATase GATase_3 DJ-1_PfpI Peptidase_C26 SNO
Other DBs
NCBI-GeneID: 938760
NCBI-ProteinID: NP_388529
Pasteur: BG10706
BSORF: BG10706
UniProt: P12041 A0A6M3Z8Q7
Position
702570..703253
AA seq 227 aa
MKFAVIVLPGSNCDIDMYHAVKDELGHEVEYVWHEETSLDGFDGVLIPGGFSYGDYLRCG
AIARFANIMPAVKQAAAEGKPVLGVCNGFQILQELGLLPGAMRRNKDLKFICRPVELIVQ
NDETLFTASYEKGESITIPVAHGEGNFYCDDETLATLKENNQIAFTYGSNINGSVSDIAG
VVNEKGNVLGMMPHPERAVDELLGSADGLKLFQSIVKNWRETHVTTA
NT seq 684 nt   +upstreamnt  +downstreamnt
gtgaaatttgcggtgattgtgttacccggctccaactgtgatatcgatatgtatcatgct
gtaaaggatgagctcggccatgaagtggaatacgtctggcatgaggaaacaagccttgac
ggcttcgacggcgtgttaattccgggaggattttcttacggcgattacttaagatgcggc
gccatcgcccgatttgcgaatattatgccagctgtcaaacaagcagcggctgaaggaaaa
cctgttcttggcgtctgtaacggattccagattttacaggagcttgggctgctgccaggc
gcaatgagacgcaacaaagatctgaagttcatttgccgtccggttgaattgattgttcag
aacgacgaaaccttattcacagcttcctacgaaaagggagaatcgattacaatcccggtt
gcccatggtgaagggaatttctactgtgatgacgagacgcttgctacattaaaggaaaac
aatcaaattgctttcacatacggctctaatattaatggaagtgtcagcgacattgccggt
gtcgtgaatgagaaaggcaatgtattaggcatgatgcctcaccctgagcgcgcggtcgat
gaactgcttggaagcgccgacggtcttaaattgttccagtctatcgtgaaaaattggagg
gaaactcatgtcactactgcttga

DBGET integrated database retrieval system