KEGG   Bacillus subtilis subsp. subtilis 168: BSU06480
Entry
BSU06480          CDS       T00010                                 

Symbol
purL
Name
(RefSeq) phosphoribosylformylglycinamidine synthase
  KO
K23269  phosphoribosylformylglycinamidine synthase subunit PurL [EC:6.3.5.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU06480 (purL)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     BSU06480 (purL)
SSDB
Motif
Pfam: AIRS AIRS_C FGAR-AT_linker
Other DBs
NCBI-GeneID: 939233
NCBI-ProteinID: NP_388530
Pasteur: BG10705
BSORF: BG10705
UniProt: P12042 A0A6M3Z8J7
Position
703237..705465
AA seq 742 aa
MSLLLEPSKEQIKEEKLYQQMGVSDDEFALIESILGRLPNYTEIGIFSVMWSEHCSYKNS
KPILRKFPTSGERVLQGPGEGAGIVDIGDNQAVVFKIESHNHPSALEPYQGAATGVGGII
RDVFSMGARPIAVLNSLRFGELTSPRVKYLFEEVVAGIAGYGNCIGIPTVGGEVQFDSSY
EGNPLVNAMCVGLINHEDIKKGQAKGVGNTVMYVGAKTGRDGIHGATFASEEMSDSSEEK
RSAVQVGDPFMEKLLLEACLEVIQCDALVGIQDMGAAGLTSSSAEMASKAGSGIEMNLDL
IPQRETGMTAYEMMLSESQERMLLVIERGREQEIIDIFDKYDLEAVSVGHVTDDKMLRLT
HKGEVVCELPVDALAEEAPVYHKPSQEPAYYREFLETDVPAPQIEDANEMLKALLQQPTI
ASKEWVYDQYDYMVRTNTVVAPGSDAGVLRIRGTKKALAMTTDCNARYLYLDPEVGGKIA
VAEAARNIICSGAEPLAVTDNLNFGNPEKPEIFWQIEKAADGISEACNVLSTPVIGGNVS
LYNESNGTAIYPTPVIGMVGLIEDTAHITTQHFKQAGDLVYVIGETKPEFAGSELQKMTE
GRIYGKAPQIDLDVELSRQKALLDAIKKGFVQSAHDVSEGGLGVAIAESVMTTENLGANV
TVEGEAALLFSESQSRFVVSVKKEHQAAFEATVKDAVHIGEVTADGILAIQNQDGQQMIH
AQTKELERVWKGAIPCLLKSKA
NT seq 2229 nt   +upstreamnt  +downstreamnt
atgtcactactgcttgaaccaagtaaagaacaaataaaagaagagaaactgtatcagcaa
atgggtgtcagtgatgatgagtttgcattgatagaatccattcttggaagattgccgaac
tacacagaaatcggaattttttctgtcatgtggtctgagcattgcagctataaaaactca
aagccgattctgcgtaaattcccgacaagcggcgagcgtgtgctgcaggggccgggggaa
ggcgccggaatcgttgatatcggtgataaccaagcggttgtgttcaaaattgaatcacat
aaccacccatcagctctcgagccttaccaaggcgctgcgactggcgtaggcggaattatc
cgtgatgtattctcaatgggtgcacgcccaatcgctgtattgaactctcttcgatttggt
gaactgacttcaccccgcgtgaagtacttgtttgaagaagtagtagcgggtatcgccgga
tacggcaactgtatcggcatcccgacagtcggcggagaagtgcagtttgacagcagctat
gaaggaaatccgctcgtcaacgcaatgtgcgtcggtttaatcaaccatgaagacatcaaa
aaaggccaggcaaagggtgtcggcaacacagtaatgtacgtaggagcgaaaacagggcgt
gacggcatccacggcgctacgtttgcttctgaagaaatgtcagactcgtctgaagaaaag
cgttctgctgtccaagtcggcgatccgtttatggagaagcttttgcttgaagcatgtctg
gaagtcatccaatgcgacgccttagtcggcattcaggatatgggagctgccggtttaaca
agctcaagtgcagaaatggcaagtaaagccggttctggcattgaaatgaatcttgacctg
attcctcagcgcgaaacaggcatgaccgcgtatgaaatgatgctttctgaatcacaagaa
cggatgcttttggttattgagcgcggacgtgagcaggaaatcatcgatatttttgacaag
tatgatcttgaagcggtttctgtcggacatgtgacagatgataaaatgcttcgcctgaca
cataaaggagaggttgtgtgcgagctgcctgttgatgccttggcagaagaagcaccggtt
taccataagccttctcaagagcctgcttactatcgcgagtttttggaaacagacgttccg
gctccgcaaattgaagatgcgaatgaaatgctgaaggcccttcttcagcagccgacgatt
gcgagtaaagagtgggtttatgatcagtatgactacatggtgcgcacgaatacagttgtc
gctcctgggtctgatgctggtgttctcagaatccgcggaacgaaaaaggcgctggcgatg
acgacagactgtaacgcgcgttatctctatcttgatcctgaagtcggagggaaaattgct
gtcgctgaagcagcgcgcaacatcatttgctcaggcgcagaaccgcttgcggtgacagat
aaccttaacttcggaaaccctgagaagccggaaatcttctggcagatcgaaaaagcggca
gacggcataagcgaagcgtgcaatgttctcagcactccggttatcggcggtaacgtatcg
ctttataacgaatcaaacggcacggcgatctatccgacaccagttatcggcatggtcggc
ctaattgaagatacagcgcacattacaacacagcatttcaaacaagcaggagatctcgta
tacgtgatcggcgaaacaaaaccagagtttgccggaagcgagctgcaaaaaatgacagaa
ggccgtatttacggcaaagcgccgcaaatcgatcttgatgtagagctgtctcgtcaaaaa
gcactgcttgacgcgattaaaaaaggcttcgttcaatctgcgcatgatgtgtctgaaggc
ggcttaggcgtagcgattgcggaaagtgtcatgacgacggaaaaccttggcgctaatgtg
actgtagaaggggaagcggcgttattattctctgaatctcaatctcgcttcgtcgtttca
gtgaaaaaagaacatcaagctgcgtttgaagcaactgtcaaagatgcagttcatattggt
gaggtaacagctgacggaattctggcgattcaaaaccaagacggacaacaaatgattcat
gcgcaaacgaaagagcttgaacgcgtatggaaaggagctatcccatgcttgctgaaatca
aaggcttaa

DBGET integrated database retrieval system