KEGG   Bacillus subtilis subsp. subtilis 168: BSU06490Help
Entry
BSU06490          CDS       T00010                                 

Gene name
purF
Definition
(RefSeq) amidophosphoribosyltransferase
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00250  Alanine, aspartate and glutamate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
Module
bsu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU06490 (purF)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU06490 (purF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU06490 (purF)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     BSU06490 (purF)
Peptidases and inhibitors [BR:bsu01002]
 Cysteine peptidases
  Family C44
   BSU06490 (purF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_7 Pribosyltran GATase_4 GATase_2 DUF3700
Motif
Other DBs
NCBI-GeneID: 936046
NCBI-ProteinID: NP_388531
Pasteur: BG10707
BSORF: BG10707
UniProt: P00497
Structure
PDB: 

Position
705441..706871
Genome map
AA seq 476 aa AA seqDB search
MLAEIKGLNEECGVFGIWGHEEAPQITYYGLHSLQHRGQEGAGIVATDGEKLTAHKGQGL
ITEVFQNGELSKVKGKGAIGHVRYATAGGGGYENVQPLLFRSQNNGSLALAHNGNLVNAT
QLKQQLENQGSIFQTSSDTEVLAHLIKRSGHFTLKDQIKNSLSMLKGAYAFLIMTETEMI
VALDPNGLRPLSIGMMGDAYVVASETCAFDVVGATYLREVEPGEMLIINDEGMKSERFSM
NINRSICSMEYIYFSRPDSNIDGINVHSARKNLGKMLAQESAVEADVVTGVPDSSISAAI
GYAEATGIPYELGLIKNRYVGRTFIQPSQALREQGVRMKLSAVRGVVEGKRVVMVDDSIV
RGTTSRRIVTMLREAGATEVHVKISSPPIAHPCFYGIDTSTHEELIASSHSVEEIRQEIG
ADTLSFLSVEGLLKGIGRKYDDSNCGQCLACFTGKYPTEIYQDTVLPHVKEAVLTK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctgaaatcaaaggcttaaatgaagaatgcggcgtttttgggatttggggacat
gaagaagccccgcaaatcacgtattacggtctccacagccttcagcaccgaggacaggag
ggtgctggcatcgtagcgactgacggtgaaaagctgacggctcacaaaggccaaggtctg
atcactgaagtatttcaaaacggcgaactcagcaaagtaaagggaaaaggcgctatcggg
cacgttcggtacgcaacggctggaggcggcggatacgaaaatgttcagccgctcctcttc
cgttcccaaaacaacggcagcctggcgcttgctcataacggaaatcttgtcaacgccact
cagctgaagcagcagctcgaaaatcaagggagcatctttcaaacctcttcggatacagag
gttttggctcacctgatcaaaagaagcggacacttcacgctgaaggatcaaattaaaaac
tcgctttctatgctgaaaggcgcctacgcgttcctgatcatgaccgaaacagaaatgatt
gtcgcacttgatccaaacgggctgagaccgctatccatcggcatgatgggcgacgcttat
gtggtcgcatcagaaacatgcgcatttgacgtcgtcggcgcaacgtaccttcgcgaggta
gagccgggagaaatgctgatcattaatgatgaaggcatgaaatcagagcgtttttccatg
aatatcaatcgttccatttgcagcatggagtacatttatttctccagaccagacagcaat
attgacggtattaatgtgcacagtgcccgtaaaaaccttgggaaaatgctggctcaggaa
tccgcagttgaagctgacgtcgtaaccggggttccggattccagtatttcagcggcgatc
ggctatgcagaggcaacaggcattccgtatgagcttggcttaatcaaaaaccgttatgtt
ggcagaacgtttattcagccgtcccaggctctgcgtgagcaaggcgtcagaatgaagctg
tctgcggtgcgcggggttgtagaaggcaaacgcgtcgtgatggtggatgactctatcgtg
cgaggaacaactagccgccggattgtcacgatgctaagagaagcgggtgcgacagaggtg
catgtgaaaatcagttcaccgccgatcgctcatccgtgcttttacggcattgacacttcc
acacatgaagaactgatcgcgtcttcgcattctgttgaagaaatccgtcaggaaatcgga
gccgataccctctcatttttgagtgtggaagggctgctgaaaggcatcggcagaaaatac
gatgactcgaattgcggacagtgtctcgcttgctttacaggaaaatatccgactgaaatt
taccaggatacagtgcttcctcacgtaaaagaagcagtattaaccaaataa

DBGET integrated database retrieval system