KEGG   Bacillus subtilis subsp. subtilis 168: BSU06520
Entry
BSU06520          CDS       T00010                                 

Symbol
purH
Name
(RefSeq) bifunctional purine biosynthesis protein PurH
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00670  One carbon pool by folate
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU06520 (purH)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BSU06520 (purH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU06520 (purH)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     BSU06520 (purH)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     BSU06520 (purH)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSU06520 (purH)
SSDB
Motif
Pfam: AICARFT_IMPCHas MGS LpxI_C
Other DBs
NCBI-GeneID: 936053
NCBI-ProteinID: NP_388534
Pasteur: BG10710
BSORF: BG10710
UniProt: P12048 A0A6M4JKT5
Position
708594..710132
AA seq 512 aa
MTIKRALISVSDKTNLVPFVKELTELGVEVISTGGTKKLLQENGVDVIGISEVTGFPEIM
DGRLKTLHPNIHGGLLAVRGNEEHMAQINEHGIQPIDLVVVNLYPFKETISKEDVTYEEA
IENIDIGGPGMLRAASKNHQDVTVIVDPADYSPVLNQIKEEGSVSLQKKRELAAKVFRHT
AAYDALIADYLTNVVGEKEPEQFTVTFEKKQSLRYGENPHQEATFYQTALPVKGSIAQAE
QLHGKELSYNNIKDADAAVQIVREFTEPAAVAVKHMNPCGVGTGKTIAEAFDRAFEADKT
SIFGGIIALNREVDKATAEALHNIFLEIIIAPSFSQEALDVLTAKKNLRLLTLDVSAAVQ
KEKQLTSVQGGLLIQDLDMHGFDDAEISIPTKREPNEQEWEDLKLAWKVVKHVKSNAIVL
AKDNMTVGVGAGQMNRVGSAKIAIEQAGEKAKGSALGSDAYFPMPDTVEEAAKAGVTAII
QPGGSIRDEDSIKKADEYGIAMVFTGIRHFKH
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgaccattaaacgtgcattaatcagtgtttcagataaaacaaatctcgttcctttcgta
aaagaactgacagagcttggcgttgaagtcatctccacaggcggaacgaaaaagcttctt
caagaaaacggtgtggatgtgatcggaatttctgaagtgacaggctttcctgaaattatg
gacggccggttaaaaaccctacacccgaatattcacggcggccttctggcggttcgcggc
aatgaagagcatatggcgcagatcaatgaacacgggattcagccgattgacctcgttgtc
gtcaacctctatccatttaaagaaacgatttctaaagaagacgtcacgtatgaagaagcg
atcgaaaatatcgacatcggcggacctggcatgctgcgcgcggcatcaaagaaccatcag
gatgtcacggttatcgtcgatccggccgattacagcccagtgctaaatcaaatcaaagaa
gaaggcagcgtatctcttcagaaaaaacgcgagctcgcggcaaaagtattccgtcatact
gcggcatatgatgcactgatcgctgactatctgacaaatgttgtcggtgaaaaagaacca
gagcaattcactgtgacatttgagaaaaaacaatcgcttcgctatggagaaaacccgcat
caggaagcaactttctatcaaacagctcttcctgtcaaaggctccattgcgcaagcagaa
cagcttcacggaaaagagctttcttacaacaacattaaagacgcggatgctgcagttcaa
atcgttcgtgaattcactgaaccggctgctgttgctgtgaagcatatgaacccgtgcggc
gtgggaacaggaaaaacgatcgcagaagcgtttgacagagcgtttgaagcggataaaaca
tctatcttcggcggcattatcgcgctgaaccgtgaagtggacaaggcaactgccgaagcg
cttcacaacattttcttagaaatcatcattgcgccttcattcagccaagaagcgctcgac
gtcctgactgcgaagaaaaatctccgtctgctgacgcttgacgtatccgccgctgttcaa
aaggaaaaacagctgacatccgttcaaggcgggctgctgattcaagatttagatatgcac
ggcttcgatgatgctgagattagcattccgacaaaaagagagccgaacgagcaagagtgg
gaagacttgaagcttgcttggaaagtcgtgaagcatgtgaaatcaaatgcgattgttctc
gcgaaggacaacatgacagtcggcgtgggagcaggccaaatgaaccgcgtcggatcggca
aaaatcgcaatcgagcaagcaggggaaaaagcgaagggcagcgcgctcggttcggatgca
tatttcccaatgccagatactgtcgaagaagcggcaaaagcgggcgttacagccatcatt
cagccaggcggatcgatccgagatgaggattccatcaaaaaagcggatgaatacggcatt
gccatggtattcaccggcatcagacacttcaaacattaa

DBGET integrated database retrieval system