KEGG   Bacillus subtilis subsp. subtilis 168: BSU06530
Entry
BSU06530          CDS       T00010                                 

Gene name
purD
Definition
(RefSeq) phosphoribosylamine--glycine ligase
  KO
K01945  phosphoribosylamine---glycine ligase [EC:6.3.4.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU06530 (purD)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     BSU06530 (purD)
SSDB
Motif
Pfam: GARS_A GARS_N GARS_C ATP-grasp_3 CPSase_L_D2 ATP-grasp ATP-grasp_4 ATP-grasp_5 ATP-grasp_2 Dala_Dala_lig_C RimK
Other DBs
NCBI-GeneID: 938741
NCBI-ProteinID: NP_388535
Pasteur: BG10711
BSORF: BG10711
UniProt: P12039 A0A6M3Z844
Structure
PDB: 
2XCL 2XD4

Position
710148..711416
AA seq 422 aa
MNVLIIGKGGREHTLAWKAAQSSLVENVFAAPGNDGMAASAQLVNIEESDHAGLVSFAKQ
NQVGLTIVGPEVPLIEGLVDEFEKAGLHVFGPSKAAAIIEGSKQFAKDLMKKYDIPTAEY
ETFTSFDEAKAYVQEKGAPIVIKADGLAAGKGVTVAMTEEEAIACLHDFLEDEKFGDASA
SVVIEEYLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFDGDKGPNTGGMGAYSPVPQISEE
TVRHAVETIVKPAAKAMVQEGRSFTGVLYAGLMLTENGSKVIEFNARFGDPETQVVLPRM
ESDLVQVLLDLLDDKEVDLRWKDTAAVSVVLASEGYPESYAKGTPIGSLAAETEQVVVFH
AGTKAEGGEFVTNGGRVANVTAFDETFEAARDRVYKAVDEIFKPGLFFRKDIGARALKAA
QK
NT seq 1269 nt   +upstreamnt  +downstreamnt
gtgaatgtattaattatcggtaaaggcggaagagaacatacgctggcgtggaaggcagcg
caaagcagcctcgtcgagaatgtatttgccgctcccggaaatgacggcatggcagcttcc
gctcagcttgtaaacattgaggaaagcgaccacgcagggcttgtctcatttgcaaaacaa
aatcaggtcggcctgaccattgtcggccctgaggttcctttaattgaaggtctggtggat
gaattcgaaaaagcgggcttacatgtgttcggtccgtcaaaagctgcggcgatcatcgaa
ggaagcaaacagttcgctaaggatttaatgaagaaatacgacattccgaccgcagaatac
gagacgtttacatcctttgatgaggcgaaggcatatgtgcaggaaaaaggtgctccgatt
gtgataaaagcagatggacttgcagctggaaaaggcgttactgtggctatgacagaggaa
gaagcaattgcgtgcttgcatgactttcttgaagatgaaaagttcggtgatgcgagcgcg
tccgttgtcattgaagaatatctttctggtgaagaattttctctaatggcctttgtcaaa
ggggaaaaggtgtatccgatggtgattgcccaggatcacaagcgggcgtttgacggagac
aaaggcccgaatacaggcggcatgggcgcctactcgccagttccgcaaatttcggaagaa
acggtccgccatgctgtagaaacgatcgttaagccggctgcaaaagcaatggtacaagaa
ggccgttccttcactggcgttttgtacgctggattgatgcttactgaaaacggctcgaag
gtcattgaatttaatgcccgtttcggcgatccggaaacacaggtcgtgcttccgcgcatg
gaatctgatctggtacaggtgcttcttgatcttttagatgataaggaagttgacttaaga
tggaaggataccgcggcagtgagtgttgtgcttgcatcagaagggtatccggaaagctat
gcaaaaggcacgccgatcggcagccttgcagcagaaactgagcaggtcgtggtcttccat
gccggaacgaaagcagaaggtggagagttcgttacaaacggggggcgcgtcgccaatgtg
acggcttttgatgaaacgtttgaagcggctagagaccgagtgtacaaagcggttgatgaa
attttcaaaccgggactctttttcagaaaagacattggggcacgcgctttaaaggctgcc
caaaaataa

DBGET integrated database retrieval system