KEGG   Bacillus subtilis subsp. subtilis 168: BSU06550
Entry
BSU06550          CDS       T00010                                 

Gene name
yecA
Definition
(RefSeq) amino acid permease
  KO
K16263  amino acid efflux transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU06550 (yecA)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU06550 (yecA)
SSDB
Motif
Pfam: AA_permease_2 AA_permease Spore_permease
Other DBs
NCBI-GeneID: 936051
NCBI-ProteinID: NP_388537
Pasteur: BG12817
BSORF: BG12817
UniProt: O34560 A0A6M4JDQ7
Position
712019..713293
AA seq 424 aa
MLPELQRSITWIQGTALTIGAVLGCGILILPSVTADTAGPASLFVWVFMSFLSFFLVGTL
ARLVKIAPSAGGITAYVQLAFQKKAGAILGWIMLGSVPIGVPIIALTGAHYVSYITEAAD
WQITLIAGCMLAISILLHMRGIQLSANISTLVICVIVFLLVTSIAVSLPHVTIAEFKPFL
PHGWSAAGSVSVMIFFSFVGWEMITPLAEEFHRPEKDVPLSLFLAASCVAGLYIMLSFVT
VGTHSYGENGEIASLAMLISKGAGESGVYVTVCLALFITFATIHANIAGFSRMVYALARE
GHIPVFFGKLSATKRTPIRVLTAMAAVFGLVLAAHGLFQIDLTTLLKGPSAAFIASYICT
MAAALKLLGRRDIGWWMALGAFVACAVIYSFSGWALLYPAVLAAAGYFYMKTKGGHKKKL
DHVL
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgttgccagaattgcagcgctctattacttggatacaagggacggcgttaacgattggg
gcggttttaggatgcgggatattaatcctgccgtctgtcaccgcggacacggccggcccc
gcttctttatttgtttgggtgttcatgtccttcttatccttttttcttgtcggcacgctg
gcccggcttgtgaaaatagcgcctagcgcgggaggaatcacggcttatgtgcagctggcc
tttcagaaaaaagccggggctattttgggctggatcatgttagggtccgttccgatcggc
gttcccatcatcgctttgactggcgcgcattacgtcagttacatcacagaggcggccgat
tggcagattacattgattgctggttgcatgctggctatatctattttgcttcatatgaga
gggattcaactatcagcaaacattagtacactcgttatatgtgtcatcgtatttctgctt
gtcacttctattgctgtgtcattgccacacgtcacgatagcagaattcaagccgtttctt
ccgcatggctggtctgccgctggatctgtttctgttatgatttttttctcttttgtaggc
tgggaaatgattaccccgttggctgaggaatttcatcgtcctgaaaaagatgtcccgctc
agcttgtttttggcagcgtcttgtgtggcggggctgtatatcatgctgtcatttgtgacc
gtgggtactcattcatatggagagaatggagaaattgcatcgcttgccatgctcatttca
aaaggagcaggagaaagcggtgtatatgtcacggtatgtttagcgctgtttattacattc
gccaccatccatgccaatattgccggtttttcaagaatggtgtacgcattggcgagagag
gggcacatacccgtattttttggaaaactcagtgcgacaaaacgtacgcctattcgcgtt
ttgacagcgatggccgcagtgtttggcttagtgcttgcagcgcatggtctgtttcaaatc
gatttgacgactctgttgaaagggccgagcgcggcttttatcgcatcttacatatgtaca
atggcggcagcactgaaactgctgggcaggagagatataggctggtggatggcgctcggg
gcatttgtggcgtgcgcggtgatttattcattcagcggctgggcactgctttatccggca
gtgctggcagctgcaggatatttctatatgaaaacaaagggtgggcataaaaaaaagctt
gatcacgttttgtga

DBGET integrated database retrieval system