KEGG   Bacillus subtilis subsp. subtilis 168: BSU06559
Entry
BSU06559          CDS       T00010                                 

Symbol
yezF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2892 DUF2784 CKI Claudin_2
Other DBs
NCBI-GeneID: 8302929
NCBI-ProteinID: YP_003097691
UniProt: C0H3X3 A0A6M3ZDF2
Position
complement(713308..713535)
AA seq 75 aa
MKPNISLINAVFRIACGLTIMSAASAKFTKKPWCRMHLFYIFMGAMKAGSGILRFCPVTY
MFQHSDSGNNEHQNG
NT seq 228 nt   +upstreamnt  +downstreamnt
ttgaagccaaacatcagtctcatcaatgccgtgttcagaatcgcctgcggattgacgatt
atgtcagccgccagtgcaaagtttacgaaaaaaccttggtgcagaatgcatctcttttac
atctttatgggggccatgaaagcgggttcgggaatcttgcgcttctgtcctgtgacctac
atgtttcaacacagcgattctggaaataacgagcatcaaaacggataa

DBGET integrated database retrieval system