KEGG   Bacillus subtilis subsp. subtilis 168: BSU06570
Entry
BSU06570          CDS       T00010                                 

Symbol
yerB
Name
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3048 DUF3048_C DUF2793
Other DBs
NCBI-GeneID: 936050
NCBI-ProteinID: NP_388539
Pasteur: BG12830
BSORF: BG12830
UniProt: O34968 A0A6M4JG31
Structure
PDB: 
2PSB

Position
715433..716428
AA seq 331 aa
MKKWMTVCALCFVFFLLVSCQQKDAVPDTAKKLKAPLTGLKTEQKVTERRPVAVVVNNHP
KARPQSGLSKADIVIEALAEGQITRFLAIFQSQMPETVGPVRSAREYFVTLSNGFDSIFV
HHGWSPGAKKQLESGAADYMNGLDFDGSLFWRADFSKPPHNSYTSYDYIKKAAEQKGYKL
KQETNPLLFQTSDAKPANESYNVRVDYGTNNVTNLVEYNYDKKAEFYTRSSDGVITTDRE
TGKPVAMQNIFIVEASHHIIDQDGRRDIDLESGGKGLLFQHGNVIETDWKQVNGRIVPVK
DGKWLPFVPGKTWINIVPDLDAASISKGEGV
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaaaaaatggatgacagtttgcgcgctgtgtttcgtgttttttctgctggtatcctgc
cagcagaaggatgctgtcccggatactgcaaagaagctgaaagctcctttaacggggcta
aagactgaacagaaagtgactgaacgccgccctgttgctgttgtggtgaacaatcacccg
aaggcgaggccgcagtcgggtctgtctaaagccgacattgtcatagaagcgctagccgaa
gggcaaatcacaagatttctggccattttccaaagccagatgcctgaaactgtcggacct
gtgcggagcgcgcgggaatatttcgtcactctcagcaatggctttgacagcatatttgtc
catcacggctggagtcccggcgccaaaaagcagctggaatccggagctgccgattatatg
aacggattggattttgacggaagcttattttggagagctgatttcagcaaaccgccccac
aattcctatacgtcttatgattacataaaaaaggcggcagaacaaaagggttataagctg
aagcaggaaacaaatccgctgctgtttcaaacatcagatgcaaaacctgcaaatgaatct
tacaatgttcgggtagattatggaacaaataacgttacaaatcttgtcgaatacaactat
gataaaaaagctgaattttatacaagaagctctgatggtgtcataacgacagaccgggaa
accggaaagccggttgcaatgcaaaatattttcattgttgaagccagccatcatattatt
gatcaagatggaaggcgggacatcgacttggaatcaggaggaaaaggtctgttgtttcag
cacggaaacgtcattgaaacagactggaaacaagtgaatggcagaattgtgccggtaaaa
gacggcaagtggcttccgtttgtgccaggaaagacttggatcaatatcgtacctgatctt
gatgcggcttccattagtaaaggagaaggtgtgtaa

DBGET integrated database retrieval system