KEGG   Bacillus subtilis subsp. subtilis 168: BSU06580
Entry
BSU06580          CDS       T00010                                 

Symbol
yerC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Trp_repressor HTH_38 HTH_23 HTH_28
Other DBs
NCBI-GeneID: 936049
NCBI-ProteinID: NP_388540
Pasteur: BG12831
BSORF: BG12831
UniProt: Q7BVT7 A0A6M3Z858
Position
716431..716745
AA seq 104 aa
MQIDKLRGKELDQLFNSILSLKDLEECYRFFDDLCTINEIQSLAQRLEVARMLREGNTYH
KIETETGASTATISRVKRCLNYGNDAYEMALDRVKETETESSSK
NT seq 315 nt   +upstreamnt  +downstreamnt
atgcaaatcgataaattacgcggcaaagagctggaccagttatttaactcgatcttatcg
ctgaaagacctggaggaatgttaccgattcttcgatgatctatgcacaattaacgaaatt
caatcgctggctcagcgccttgaagtggcgcgcatgcttcgcgaaggaaacacgtatcat
aagattgaaacagaaacaggcgcttccacggctacgatttcccgtgtgaaacgctgctta
aattacggaaatgacgcttatgaaatggcgcttgaccgtgtgaaggagacggaaacagag
tcttcttccaaataa

DBGET integrated database retrieval system