KEGG   Bacillus subtilis subsp. subtilis 168: BSU06590
Entry
BSU06590          CDS       T00010                                 

Symbol
yerD
Name
(RefSeq) glutamate synthase large subunit-like protein YerD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Glu_synthase FMN_dh Glu_syn_central IMPDH
Other DBs
NCBI-GeneID: 936058
NCBI-ProteinID: NP_388541
Pasteur: BG12832
BSORF: BG12832
UniProt: O34849 A0A6M3Z825
Position
complement(716780..718357)
AA seq 525 aa
METIIIALIAFIIGIIAIPIVLFAWIYIKDEKQQEHSILRNYPVIGRFRYILEKIGPELR
QYLYSNDNEEQPFSRKEYEQTVISGKYKSRMMGFGSVRDFDKPGYYIRNAMFPKQREEMH
VNQTPKIETQIYKMDADNLFKRKEHAEHIKADPYFLHPDDVQVIGEHTCEKPFYVKGLVG
QSAMSYGSLGERAVTALSKGLHLAGGTWMNTGEGGLSEYHLKGGADIICQIGPGLFGVRK
RNGEFSWEEFKRKSRIDQIKAFELKLAQGAKTRGGHVDGAKVSEEVADIRNVEPGKSIDS
PNRFYEFSNPPEMLDFIEKLRDVGQKPVGIKLVAGHPEELHELFSHMQKSGKHPDFITID
GSEGGTGASFYELADTVGLPIMTALPIVDTLLKQYGLRSQLKIFASGKLLTPDKIAVALA
LGADFVNIARGMMFSVGCIRALVCHTNTCPAGVATTDPKLQKALSVEEKQHRVCNYVISL
REGLFNLAAAAGINSPIHFSKEHVVYRKEDGSIINIDNLIHQFVS
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggaaaccatcataatagcactcatcgcatttatcattgggatcatcgctatcccgatc
gtcttgtttgcctggatctacataaaggatgaaaaacagcaggagcactcaattcttcgc
aactatcccgtcatcggaaggtttcggtatatccttgaaaaaatcgggccggagctcaga
cagtatttatacagcaatgacaatgaagagcagccattttcacgaaaggaatatgagcaa
accgtcatctccggcaaatacaaaagcagaatgatgggctttggatctgtaagagatttt
gataaacctggctattatatccgtaacgctatgtttccaaaacaaagggaagaaatgcat
gtaaatcaaacgccaaaaattgaaacccaaatctataaaatggatgctgacaatctgttc
aaacgcaaggagcatgccgaacatatcaaggcagacccgtattttctccatcctgatgat
gtacaggtgattggcgagcatacatgcgagaagccattttatgtgaagggcttagtcggc
cagtctgccatgagctacggttctcttggagaacgggctgttacggcgctctcaaaaggg
ctccatctggcaggcggcacctggatgaatacaggtgaagggggattgtctgaatatcac
ttaaagggcggcgccgatatcatttgccaaatcggaccgggcctattcggcgtgcgcaaa
agaaacggggaattttcgtgggaggaatttaaaagaaaaagcaggattgaccagattaaa
gcgtttgagctaaagctggcacaaggagcgaaaacccgcggcggccatgtggacggcgcc
aaagtatcagaggaagtggcagacattcggaatgtcgaacctggaaagtcgattgacagc
ccgaaccgcttttatgaattctcaaaccctcctgaaatgctcgactttattgaaaaactt
agagatgtcggacaaaagccagtcggcatcaaactggtcgcagggcatcctgaagaattg
catgagcttttctctcatatgcagaaaagcggaaagcatccggattttatcacgatcgac
ggaagtgaaggcggtaccggagcttccttttacgagctcgcggatacagtcggccttccg
attatgacagcgctgcctattgtggacacgcttcttaaacagtacggcttgcgcagccag
ctgaaaatctttgcttccggaaagctcctgactcctgataaaatcgcggtcgccttagcc
ctcggcgctgactttgttaacatcgcacgcggcatgatgttttccgttggctgcatccgc
gctctcgtctgccacaccaacacctgtccggcaggtgtggcgacgacagatccgaaattg
caaaaagcactgagcgttgaggaaaaacagcatcgtgtctgcaactacgttatttcattg
cgcgagggactatttaaccttgcagccgcagcagggattaattcgccgattcatttttcc
aaggagcatgttgtctatcggaaagaggatggcagtatcatcaatatcgacaacctgatc
catcaatttgtttcataa

DBGET integrated database retrieval system