KEGG   Bacillus subtilis subsp. subtilis 168: BSU06600
Entry
BSU06600          CDS       T00010                                 

Symbol
pcrB
Name
(RefSeq) heptaprenylglyceryl phosphate synthase
  KO
K07094  heptaprenylglyceryl phosphate synthase [EC:2.5.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00564  Glycerophospholipid metabolism
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSU06600 (pcrB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.-  
     BSU06600 (pcrB)
SSDB
Motif
Pfam: PcrB His_biosynth Trp_syntA Ribul_P_3_epim
Other DBs
NCBI-GeneID: 936052
NCBI-ProteinID: NP_388542
Pasteur: BG12833
BSORF: BG12833
UniProt: O34790 A0A6M4JE05
Structure
Position
718622..719308
AA seq 228 aa
MYDVTEWKHVFKLDPNKDLPDEQLEILCESGTDAVIIGGSDGVTEDNVLRMMSKVRRFLV
PCVLEVSAIEAIVPGFDLYFIPSVLNSKNADWIVGMHQKAMKEYGELMSMEEIVAEGYCI
ANPDCKAAALTEADADLNMDDIVAYARVSELLQLPIFYLEYSGVLGDIEAVKKTKAVLET
STLFYGGGIKDAETAKQYAEHADVIVVGNAVYEDFDRALKTVAAVKGE
NT seq 687 nt   +upstreamnt  +downstreamnt
gtgtacgatgtaacggagtggaagcatgtctttaaactcgatccaaataaagatttgcct
gacgaacagctggagattctttgcgaatcaggaacggatgcggtcattatcggaggaagc
gatggtgtgacagaggataatgtcctgcggatgatgtctaaggtaagacggtttttggtg
ccgtgtgtcctagaggtatcagcgattgaagcgattgttcccggctttgacttatatttt
attccgagtgtattaaacagcaaaaacgcggattggattgtcggaatgcaccagaaagcc
atgaaggaatacggagaactgatgtctatggaagaaatcgtggcggagggctactgcatc
gcaaatccagattgcaaagccgcggcactgactgaagcggacgccgatctgaatatggat
gatattgtcgcctatgcgcgtgtgtcggagctgctgcaactgccgattttttatttagaa
tacagcggcgtgcttggagacatagaagctgtcaagaaaacgaaggctgtattggaaacg
tccaccttgttttacggcggcggcatcaaggatgcggaaacggccaagcagtacgcagag
catgcggacgtgatcgttgtaggcaatgcggtgtatgaagattttgacagggctttgaaa
acagtagcggctgtgaaaggcgagtag

DBGET integrated database retrieval system