KEGG   Bacillus subtilis subsp. subtilis 168: BSU06620Help
Entry
BSU06620          CDS       T00010                                 

Gene name
ligA
Definition
(RefSeq) DNA ligase
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03030  DNA replication
bsu03410  Base excision repair
bsu03420  Nucleotide excision repair
bsu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BSU06620 (ligA)
   03410 Base excision repair
    BSU06620 (ligA)
   03420 Nucleotide excision repair
    BSU06620 (ligA)
   03430 Mismatch repair
    BSU06620 (ligA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU06620 (ligA)
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU06620 (ligA)
Enzymes [BR:bsu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     BSU06620 (ligA)
DNA replication proteins [BR:bsu03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     BSU06620 (ligA)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     BSU06620 (ligA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     BSU06620 (ligA)
   MMR (mismatch excision repair)
    DNA ligase
     BSU06620 (ligA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BSU06620 (ligA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 BRCT HHH_5 DNA_ligase_ZBD HHH PTCB-BRCT zf-NADH-PPase 5_3_exonuc RNA_pol_A_CTD SSPI HHH_3 zf-tcix Zn-ribbon_8 zf-IS66
Motif
Other DBs
NCBI-GeneID: 936056
NCBI-ProteinID: NP_388544
Pasteur: BG12835
BSORF: BG12835
UniProt: O31498
Position
721613..723619
Genome map
AA seq 668 aa AA seqDB search
MDKETAKQRAEELRRTINKYSYEYYTLDEPSVPDAEYDRLMQELIAIEEEHPDLRTPDSP
TQRVGGAVLEAFQKVTHGTPMLSLGNAFNADDLRDFDRRVRQSVGDDVAYNVELKIDGLA
VSLRYEDGYFVRGATRGDGTTGEDITENLKTIRNIPLKMNRELSIEVRGEAYMPKRSFEA
LNEERIKNEEEPFANPRNAAAGSLRQLDPKIAAKRNLDIFVYSIAELDEMGVETQSQGLD
FLDELGFKTNQERKKCGSIEEVITLIDELQAKRADLPYEIDGIVIKVDSLDQQEELGFTA
KSPRWAIAYKFPAEEVVTKLLDIELNVGRTGVITPTAILEPVKVAGTTVSRASLHNEDLI
KEKDIRILDKVVVKKAGDIIPEVVNVLVDQRTGEEKEFSMPTECPECGSELVRIEGEVAL
RCINPECPAQIREGLIHFVSRNAMNIDGLGERVITQLFEENLVRNVADLYKLTKERVIQL
ERMGEKSTENLISSIQKSKENSLERLLFGLGIRFIGSKAAKTLAMHFESLENLKKASKEE
LLAVDEIGEKMADAVITYFHKEEMLELLNELQELGVNTLYKGPKKVKAEDSDSYFAGKTI
VLTGKLEELSRNEAKAQIEALGGKLTGSVSKNTDLVIAGEAAGSKLTKAQELNIEVWNEE
QLMGELKK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagaaacagcgaagcagcgggcagaagaactgcgccgcaccatcaacaagtat
agctatgaatattacaccttagatgaaccgagcgtcccagatgccgaatacgacagattg
atgcaggagctgatcgcgatcgaggaggagcacccagacctcagaacgcctgactctcct
acgcagcgcgtcggcggagccgtgcttgaagcgtttcagaaagtcacccacggcacaccg
atgctcagtctgggcaacgcctttaatgctgatgatcttcgtgatttcgaccgccgtgtg
cgccagtccgtcggcgacgatgtggcgtataatgtggagctgaaaatagacggtcttgct
gtttctctccgttatgaagacggctattttgtcagaggggccacaagaggtgacgggacg
acgggagaggatatcacggagaatctgaagacgatccgcaatatcccccttaaaatgaac
cgtgagctgtcgatcgaagtgcgcggcgaggcgtatatgccgaagcgttcgtttgaagca
ctcaatgaggaacggattaaaaatgaggaagaaccgttcgccaatccgcgaaatgccgcg
gcgggatctctcagacagctcgatccgaaaattgcagcgaaacgaaacctcgatatcttc
gtctacagtatagcggagcttgacgagatgggtgtagagacgcaaagccaagggcttgat
tttctcgacgaactcggatttaaaacgaatcaggaacgaaaaaaatgcggcagcatagaa
gaagtcattacgctgatcgatgagcttcaggcgaagcgcgcggacctgccgtacgaaata
gacggcattgtcattaaagtcgattctctcgatcaacaggaggagctcggttttacggcg
aaaagcccgcgctgggccatcgcgtataagtttcctgctgaagaggtcgtgacgaagctt
ctcgatatcgaattaaatgtcggcagaacgggtgtgattacgccgactgcgattcttgag
ccggtaaaagttgccggcacaacggtctcaagagcatcccttcataacgaagatttaatt
aaagagaaggacattcggattttggataaggttgtcgtcaaaaaagcgggcgatatcatc
ccggaagttgtgaatgtcctcgttgaccagcgcacaggagaagaaaaggaattcagcatg
ccgacggaatgtcctgaatgcggcagtgaactcgtccggatcgaaggagaagtggcgctt
cgctgcattaaccctgaatgtccggcgcaaatccgggaagggcttatccatttcgtttcc
cggaatgccatgaacattgatgggctcggcgaacgagtgatcacacagctgtttgaggaa
aaccttgtccgcaatgtggcagatttatataagctgacgaaggaacgagtcatccagctc
gagcgcatgggcgaaaagtccactgaaaacctgatcagctccatccaaaaatcaaaagaa
aattcgttagagcgcctgctgtttgggcttggcatccgttttatcggatcaaaggccgca
aagacgcttgccatgcattttgaaagcttggagaacctgaaaaaagcctctaaagaggaa
cttctcgcggtagatgaaatcggtgaaaaaatggctgatgctgtgatcacctattttcat
aaagaagaaatgcttgaactcttgaatgaacttcaggagctgggcgtaaacacgctctac
aaaggcccgaaaaaagtaaaagcagaggacagcgactcttactttgctggtaaaacaatt
gttctgacaggaaagctggaagagctgtcaagaaacgaagccaaagcgcaaatcgaagcg
ctgggcggaaagctgactggaagcgtcagcaaaaacacagacttagtcatcgccggagaa
gcggcgggaagcaagctgacaaaagcacaagagctgaacattgaagtgtggaatgaagaa
cagttaatgggagagctaaagaaataa

DBGET integrated database retrieval system