KEGG   Bacillus subtilis subsp. subtilis 168: BSU06630
Entry
BSU06630          CDS       T00010                                 

Symbol
yerH
Name
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: CamS
Other DBs
NCBI-GeneID: 938744
NCBI-ProteinID: NP_388545
Pasteur: BG12836
BSORF: BG12836
UniProt: O34629 A0A6M3ZBE2
Position
723635..724825
AA seq 396 aa
MKKTLALAATAAVLMLSACSSGFGGEKEEEITQKTAKSSEKAIVPKYNISDSYYKMVLPF
KAGKARGLTTEQLNTRLDIDEFETGLMRLAQDSFSTDDYLFQEGQYLDEDTVLSWLARKK
TGSDLKKAEKEDKNFKNEGLNPALPSSGSTEEKNESSPIYLASMLEHDYLVRKDKNSIQL
GGVMIGLALNSVYYYREKTGDPQKEVEIKDSTLRQQGEKIAQEVINRLRKKDNLKNVPIT
VALYKQASKTSIVPGNFIAKTEVKAGSTDISNWDDINEKYVFYPADTTTAEKYPDDTEVF
KRFKNSIEEYFPNYTGVVGTALYENDEMKKMKIDIPMQFYGKSEVVAFTQFLTGEVMDYY
SKSSVDVEVNITSSDGQEAVIIRNAGDKEPTVHIYD
NT seq 1191 nt   +upstreamnt  +downstreamnt
ttgaaaaagacgttggcattggcggcaacggcggcagtattaatgctgtctgcctgctcg
tcaggtttcgggggggagaaggaggaagagattacgcaaaagacggcgaaatcgtcagaa
aaagcgattgtcccgaaatataatatctctgactcctattacaaaatggtgctgccgttt
aaggcaggcaaagcgcgcggcttaacaacggaacagctgaatacaaggctggacattgac
gaatttgaaacagggctgatgcgccttgcccaagattctttctcaactgacgattatctg
ttccaagaaggacaatatttagatgaggatacagtattaagctggctggcacggaaaaaa
acgggctctgatttgaaaaaagccgaaaaagaagataagaacttcaaaaatgaaggcttg
aacccggcgctcccgagttctggttcaacagaagaaaagaacgaaagcagcccaatttat
ttagcatccatgcttgagcacgattatttagtcagaaaagacaagaattctatccagctt
ggcggcgtcatgatcggactggcgttaaactcagtgtattactatcgtgaaaaaactggc
gacccgcaaaaagaagtggagattaaagacagcacgcttcgccagcagggagaaaaaatt
gcacaggaggttattaaccgcctccgcaaaaaagataacttgaagaatgtgccgattacc
gtggcgctctacaagcaggcgtcaaaaacatcgattgtgccggggaacttcatcgccaaa
acagaggtcaaagcaggctctactgatatctcaaattgggatgacatcaatgaaaaatat
gtattctatccggcggatacaaccacagcagaaaagtacccggatgacaccgaggtcttt
aagcggttcaaaaactcaattgaagaatatttcccgaactatacaggcgttgtcggtaca
gcgctgtatgaaaatgatgaaatgaagaaaatgaagattgacataccaatgcaattctac
ggaaaaagtgaagttgtcgcgtttacccagttcttaacgggtgaagtgatggactactac
tctaagagctcagttgatgtcgaagtcaatatcacgtcctcagacggacaggaagcggtc
attatccgcaatgccggagataaagagccgactgttcacatttatgactga

DBGET integrated database retrieval system