KEGG   Bacillus subtilis subsp. subtilis 168: BSU06640
Entry
BSU06640          CDS       T00010                                 

Symbol
yerI
Name
(RefSeq) hypothetical protein
  KO
K23983  amicoumacin kinase [EC:2.7.1.230]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU06640 (yerI)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.230  amicoumacin kinase
     BSU06640 (yerI)
SSDB
Motif
Pfam: APH ABC1
Other DBs
NCBI-GeneID: 936055
NCBI-ProteinID: NP_388546
Pasteur: BG12837
BSORF: BG12837
UniProt: O34640 A0A6M3Z8I8
Position
724987..725997
AA seq 336 aa
MLDVHKDIKKIFHEEQVLAEAAARYGFSKDQVRFLADAENYVYECMKDNQPYILKITHTI
RRSSDYMMGEMEWLRHLAIGGISVAKPLPSLNGKDVEAVPDGNGGSFLLRVYEKAPGQKV
DESDWNETLFYELGRYTGSMHSLTKSYKLSNPAFKRQEWDEEEQLKLRKYVPEDQIKVFQ
QADSLMNELRRLPKSQDNYGLVHADLHHGNFNWDHGKITAFDFDDIGYNWFVNDISILLY
NVLWYPVVPYDDKAAFTEEFMTHFMKGYWEENELDPAWLMIIPDFLRLRHMLIYGLLHQM
FDLNTIGEEEKEMLAGFRRDIENGTPITAFDFSALV
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgttagacgtgcataaagatatcaaaaaaatatttcatgaagagcaggttttggcagaa
gctgcagcgagatacggtttctcaaaagatcaggtgcgttttctggctgatgcggaaaac
tatgtatatgaatgtatgaaagacaatcaaccttatattttaaagattacccatacgatt
cggagatcttctgattatatgatgggagagatggaatggctccgtcaccttgcaataggg
ggaatttcagtagccaaaccgctcccgtcgctgaacggaaaagacgtagaagcagtgccg
gacggaaacggcgggtcatttttattgagagtgtatgagaaagcgccggggcaaaaagtg
gatgaatcggactggaatgaaacgctattttatgagcttggcagatacacaggcagcatg
cacagcctgacaaaaagctacaaattgagcaatcccgctttcaaaagacaggaatgggat
gaagaggagcaattaaagctgagaaaatatgtgcctgaagatcagataaaggtgtttcag
caagccgattctttgatgaatgaactgcggaggctcccgaaaagccaggacaactacggc
ttggtgcatgcggatctgcaccatggcaattttaactgggatcatggcaaaatcacggca
tttgattttgatgatatcggctacaactggtttgttaacgatattagcattcttctctac
aatgtcctgtggtatcctgttgtgccatatgatgataaagctgcgtttacagaagaattt
atgacgcattttatgaaagggtactgggaggaaaatgagcttgaccctgcatggctgatg
ataatacctgatttcctccgccttcgccatatgctgatttacggattgctgcatcagatg
tttgaccttaacacaataggagaagaggaaaaagaaatgctggccggtttcagaagagat
atagagaatggcacgccgattacagcatttgatttttcagcactggtgtag

DBGET integrated database retrieval system