KEGG   Bacillus subtilis subsp. subtilis 168: BSU06650
Entry
BSU06650          CDS       T00010                                 

Gene name
sapB
Definition
(RefSeq) peptide ABC transporter permease SapB
  KO
K07507  putative Mg2+ transporter-C (MgtC) family protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU06650 (sapB)
Transporters [BR:bsu02000]
 Other transporters
  Others
   BSU06650 (sapB)
SSDB
Motif
Pfam: MgtC ABC2_membrane_5 ACT_4
Other DBs
NCBI-GeneID: 936054
NCBI-ProteinID: NP_388547
Pasteur: BG11845
BSORF: BG11845
UniProt: Q45514 A0A6M4JFP1
Position
complement(726035..726733)
AA seq 232 aa
MLLSWYIDPDILLKLGIATLIGMVIGLERELKNKPLGLKTCIVIAVSSCMLTIVSINAAY
HFPKYYRIMMDPLRLPAQIISGVGFIGAGVILRKSNDVISGLTTSAMIWGAAGLGLATGA
GFYKEAFASLLFILISVEFLPWVVRKIGPDRLQEKDIRIRMSLSDKDKMTEILKEMKRRD
IKAHSVRIDDLGEKDFPIMEVKVRVHKNRYTTDVYYDIKAIEGVVGVKCDTL
NT seq 699 nt   +upstreamnt  +downstreamnt
ttgctgttgagctggtatattgatcctgatattttattgaaattgggcattgccacattg
attggcatggtcatcgggcttgaacgcgaattaaaaaataagccgctcggattaaaaacc
tgtattgtcatcgcagtcagctcatgcatgctgacgatcgtcagtattaatgcggcatat
catttccctaaatactaccgcatcatgatggatccgcttcgtctgccggcacaaatcatc
tccggcgtcgggtttatcggcgccggtgtcatcctgcgaaaaagcaatgatgtcatttcc
ggcctgacgacatcggccatgatctggggggcagcggggctcgggcttgctacgggagcc
ggtttttataaagaagcgtttgccagtcttctgttcatcctgatcagtgtggaatttctc
ccatgggtggtcagaaaaatcggccccgaccgcctgcaggaaaaagacatccgcatcaga
atgtcactttctgataaagacaaaatgacagagattttaaaagaaatgaaaagaagagat
atcaaagcacactccgttcggatcgacgacctaggcgaaaaggattttccaattatggaa
gtgaaggtccgcgtccataaaaacagatacacgaccgatgtctactatgacattaaagcc
attgaaggcgtagtcggcgtgaagtgtgatacattataa

DBGET integrated database retrieval system