KEGG   Bacillus subtilis subsp. subtilis 168: BSU06690
Entry
BSU06690          CDS       T00010                                 

Symbol
gatB
Name
(RefSeq) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU06690 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU06690 (gatB)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BSU06690 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BSU06690 (gatB)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BSU06690 (gatB)
SSDB
Motif
Pfam: GatB_N GatB_Yqey DUF3097
Other DBs
NCBI-GeneID: 936057
NCBI-ProteinID: NP_388551
Pasteur: BG12840
BSORF: BG12840
UniProt: O30509 A0A6M4JH35
Position
730509..731939
AA seq 476 aa
MNFETVIGLEVHVELKTKSKIFSSSPTPFGAEANTQTSVIDLGYPGVLPVLNKEAVEFAM
KAAMALNCEIATDTKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEVGGKTKRIGITR
LHLEEDAGKLTHTGDGYSLVDFNRQGTPLVEIVSEPDIRTPEEAYAYLEKLKSIIQYTGV
SDCKMEEGSLRCDANISLRPIGQEEFGTKTELKNLNSFAFVQKGLEHEEKRQEQVLLSGG
VIQQETRRYDEATKKTILMRVKEGSDDYRYFPEPDLVELYIDDEWKERVKASIPELPDER
RKRYIEELGLPAYDAMVLTLTKEMADFFEETVQKGAEAKQASNWLMGEVSAYLNAEQKEL
ADVALTPEGLAGMIKLIEKGTISSKIAKKVFKELIEKGGDAEKIVKEKGLVQISDEGVLL
KLVTEALDNNPQSIEDFKNGKDRAIGFLVGQIMKASKGQANPPMVNKILLEEIKKR
NT seq 1431 nt   +upstreamnt  +downstreamnt
ttgaactttgaaacggtaatcggacttgaagtccacgttgagttaaaaacaaaatcaaaa
attttctcaagctctccaacgccattcggcgcggaggcgaatacgcagacaagcgttatt
gacctcggatatccgggcgtcctgcctgttctgaacaaagaagccgttgaattcgcaatg
aaagccgctatggcgctcaactgtgagatcgcaacggatacgaagtttgaccgcaaaaac
tatttctatcctgacaacccgaaagcgtatcagatttctcaatttgataagccaatcggc
gaaaacggctggatcgaaattgaagtcggcggcaaaacaaaacgcatcggcatcacgcgc
cttcatcttgaagaggatgccggaaaactgacgcatacgggcgacggctattctcttgtt
gacttcaaccgtcaaggaacgccgcttgttgagatcgtatcagagccggacatccgcacg
ccggaagaagcgtacgcatatcttgaaaagctgaaatccatcatccaatatacaggcgtt
tctgactgtaaaatggaagaaggctcacttcgctgtgacgccaatatctctcttcgtccg
atcggccaagaggaattcggcacaaaaacagaattgaaaaacttgaactcctttgcgttt
gttcaaaaaggccttgagcatgaagaaaaacgccaggagcaggttcttctttccggcggc
gtcatccagcaagaaactcgccgttatgatgaagcaacgaagaaaaccattcttatgcgt
gtcaaagagggatctgacgactaccgttacttcccagagccagatctagtcgagctctac
attgatgatgaatggaaggaacgcgtaaaagcaagcattcctgagcttccggatgagcgc
cgcaagcgttatatcgaagagcttggcttgcctgcatatgacgcaatggttctgacgctg
acaaaagaaatggctgatttcttcgaagaaaccgttcaaaaaggcgctgaagctaaacaa
gcgtctaactggctgatgggtgaagtgtcagcttacctaaacgcagaacaaaaagagctt
gccgatgttgccctgacacctgaaggccttgccggcatgatcaaattgattgaaaaagga
accatttcttctaagatcgcgaagaaagtgtttaaagaattgattgaaaaaggcggcgac
gctgagaagattgtgaaagagaaaggccttgttcagatttctgacgaaggcgtgcttctg
aagcttgtcactgaggcgcttgacaacaatcctcaatcaatcgaagactttaaaaacgga
aaagaccgcgcgatcggcttcctagtcggacagattatgaaagcgtccaaaggacaagcc
aacccgccgatggtcaacaaaattctgcttgaagaaattaaaaaacgctaa

DBGET integrated database retrieval system