KEGG   Bacillus subtilis subsp. subtilis 168: BSU06700
Entry
BSU06700          CDS       T00010                                 

Symbol
yerO
Name
(RefSeq) TetR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TetR_N TetR_C_29 HTH_Tnp_1_2 DUF2538 DUF6262 HTH_AraC
Other DBs
NCBI-GeneID: 939889
NCBI-ProteinID: NP_388552
Pasteur: BG12841
BSORF: BG12841
UniProt: O31500 A0A6M4JE14
Position
complement(731954..732823)
AA seq 289 aa
MNEKKERIIKTSIRLFAKKGFAATTIQEIASECGISKGAFYLHFKSKEALLLSACEYYIG
MSMNKMKNIEEDLAGKPPKEVLKKQIGAQFEDFRDHKDFIVLLLTENIIPENQEIKQYFY
KVTMETDKLYRNALLVSYGEGIERYVADLSIMARGIVHSYMNVMVFNGELNIDAEEISAF
IIERLDDLVQGLSRSALNPIVSKDIFNPMPAGKDQLLEDIQKVKENSTLPEDITVSLDVI
EEELTQDKPRKPIIKGMLSNLAGTNDKEVERLRALILSLSQFDHKKSSL
NT seq 870 nt   +upstreamnt  +downstreamnt
atgaatgaaaaaaaagagagaatcataaaaaccagcattcgtttatttgcgaaaaaagga
ttcgcagctacgacgatccaagaaatcgccagtgaatgcggcatttcgaagggcgctttt
tatttgcacttcaaatcgaaagaagcgctgctgttatctgcctgtgaatattatatcggt
atgtctatgaacaaaatgaaaaatatagaagaagatctcgccggaaagccgcctaaggaa
gtgttaaaaaagcaaattggcgctcaatttgaggattttcgcgatcataaagattttatc
gttcttttgcttaccgaaaatatcattccggaaaatcaagaaatcaagcaatacttttac
aaagtaaccatggagacggataagctgtaccggaacgccttgctggtatcctatggcgaa
ggaatcgagcggtatgtcgcagatctgtccatcatggcaagaggcattgtgcattcctat
atgaacgtgatggtatttaacggtgagcttaatatcgatgcagaagaaatctcagccttt
attattgagagactggatgatcttgtacaggggctgagccgttctgcactcaatccgatt
gtatcaaaagacatttttaacccgatgcctgcgggaaaagaccagctgcttgaggacatt
cagaaagtgaaagaaaacagcacgctgcccgaggatatcaccgtgtcacttgatgttatc
gaggaagaattgactcaggataaaccgcgcaagccgattattaaaggcatgctgtccaat
ttggccggaaccaacgacaaagaagttgaaaggcttcgggccctcatcttgtctttatct
caatttgaccataaaaaaagcagcctctaa

DBGET integrated database retrieval system