KEGG   Bacillus subtilis subsp. subtilis 168: BSU06700Help
Entry
BSU06700          CDS       T00010                                 

Gene name
yerO
Definition
(RefSeq) TetR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N TetR_C_29 HTH_Tnp_1_2 HTH_AraC
Motif
Other DBs
NCBI-GeneID: 939889
NCBI-ProteinID: NP_388552
Pasteur: BG12841
BSORF: BG12841
UniProt: O31500
Position
complement(731954..732823)
Genome map
AA seq 289 aa AA seqDB search
MNEKKERIIKTSIRLFAKKGFAATTIQEIASECGISKGAFYLHFKSKEALLLSACEYYIG
MSMNKMKNIEEDLAGKPPKEVLKKQIGAQFEDFRDHKDFIVLLLTENIIPENQEIKQYFY
KVTMETDKLYRNALLVSYGEGIERYVADLSIMARGIVHSYMNVMVFNGELNIDAEEISAF
IIERLDDLVQGLSRSALNPIVSKDIFNPMPAGKDQLLEDIQKVKENSTLPEDITVSLDVI
EEELTQDKPRKPIIKGMLSNLAGTNDKEVERLRALILSLSQFDHKKSSL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaaaaaagagagaatcataaaaaccagcattcgtttatttgcgaaaaaagga
ttcgcagctacgacgatccaagaaatcgccagtgaatgcggcatttcgaagggcgctttt
tatttgcacttcaaatcgaaagaagcgctgctgttatctgcctgtgaatattatatcggt
atgtctatgaacaaaatgaaaaatatagaagaagatctcgccggaaagccgcctaaggaa
gtgttaaaaaagcaaattggcgctcaatttgaggattttcgcgatcataaagattttatc
gttcttttgcttaccgaaaatatcattccggaaaatcaagaaatcaagcaatacttttac
aaagtaaccatggagacggataagctgtaccggaacgccttgctggtatcctatggcgaa
ggaatcgagcggtatgtcgcagatctgtccatcatggcaagaggcattgtgcattcctat
atgaacgtgatggtatttaacggtgagcttaatatcgatgcagaagaaatctcagccttt
attattgagagactggatgatcttgtacaggggctgagccgttctgcactcaatccgatt
gtatcaaaagacatttttaacccgatgcctgcgggaaaagaccagctgcttgaggacatt
cagaaagtgaaagaaaacagcacgctgcccgaggatatcaccgtgtcacttgatgttatc
gaggaagaattgactcaggataaaccgcgcaagccgattattaaaggcatgctgtccaat
ttggccggaaccaacgacaaagaagttgaaaggcttcgggccctcatcttgtctttatct
caatttgaccataaaaaaagcagcctctaa

DBGET integrated database retrieval system