KEGG   Bacillus subtilis subsp. subtilis 168: BSU06710
Entry
BSU06710          CDS       T00010                                 

Gene name
swrC
Definition
(RefSeq) surfactin self-resistance transporter
  KO
K03296  hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU06710 (swrC)
SSDB
Motif
Pfam: ACR_tran SecD_SecF NOD2_WH Methylase_S
Other DBs
NCBI-GeneID: 938055
NCBI-ProteinID: NP_388553
Pasteur: BG12842
BSORF: BG12842
UniProt: O31501 A0A6M3ZI65
Position
732916..736113
AA seq 1065 aa
MTSQSIKNVMEDMMNHVINFVLKNKFAVWLMTIIVTAAGLYAGMNMKQESIPDVNMPYLT
ISTTYPGATPSQVADEVTKPVEQAVQNLDGVSVVTSTSYENASSVMIEYDYEKDMDKAKT
EAAEALENVNLPDDAKDPEISRYSLNSFPILTLSVSSDKDNLQELTKQVEDSLVSKLEGI
EGVASVQVSGQQVEEVEFSFKEDKLKEYGLDEDTVKQVIQGSDVTTPLGLYTFGNEEKSV
VVSGDIETIKDLKNMRIPTASASSAGSSAASQAGAQSAQAAQSAQAAAQVQQSASTAVPT
VKLSDIATIKDVKKAESVSRTNGKDSIGINIVKANDANTVEVADDVKAELKKFKEDHKGF
NYSATLDMAEPITQSVDTMLSKAIFGAIFAIVIILLFLRDIKSTLISVVSIPLSLLIALL
VLQQLDITLNIMTLGAMTVAIGRVVDDSIVVIENIYRRMRLKDEPLRGKALVREATKEMF
KPIMSSTIVTIAVFLPLALVGGQIGELFIPFALTIVFALAASLVISITLVPMLAHSLFKK
SLTGAPIKAKEHKPGRLANIYKKVLNWALSHKWITSIIAVLMLLGSLFLVPLIGASYLPS
EEEKTMQLTYSPEPGETKKEAENEAEKAEKILLDRKHVDTVQYSLGSGSPLAGGDSNGAL
FYIKYESDTPDFDKEKDNVLKEIQKQSDRGEWKSQDFSSSGNNNELTYYVYGDSENDIKD
TVKDIEKIMKDEKDLKNVNSGLSSTYDEYTFVADQEKLSKLGLTASQISQALMSQTSQEP
LTTVKKDGKELDVNIKTEKDEYKSVKDLENKKITSATGQEVKIGDVAKVKEGSTSDTVSK
RDGKVYADVTGEVTSDNVTAVSAAIQKKIDKLDHPDNVSIDTGGVSADIADSFTKLGLAM
LAAIAIVYLVLVITFGGALAPFAILFSLPFTVIGALVGLYVSGETISLNAMIGMLMLIGI
VVTNAIVLIDRVIHKEAEGLSTREALLEAGSTRLRPILMTAIATIGALIPLALGFEGGSQ
VISKGLGVTVIGGLISSTLLTLLIVPIVYEVLAKFRKKKPGTEEE
NT seq 3198 nt   +upstreamnt  +downstreamnt
atgaccagtcagtcaataaaaaatgtaatggaggatatgatgaaccacgttattaatttc
gttctgaaaaacaaattcgccgtatggctgatgacgattattgtaacggcagccggcttg
tatgcgggtatgaatatgaagcaagagtctattcctgacgtgaacatgccttacttgacg
atcagcacgacatatccgggtgcaacaccaagccaagtggctgatgaagtgaccaaaccg
gttgaacaagccgtacagaacttggacggtgtcagcgttgtgacgtcgacgtcctatgaa
aacgcatcgtcggtcatgattgaatatgattatgagaaagatatggacaaagcgaaaaca
gaagcagctgaagcgttagaaaacgtcaacctgcctgatgacgcgaaggatccggagatt
tcacgctacagcttgaactcattcccgattctgacgctgagcgtgtccagtgataaagat
aatctgcaagagctgacgaaacaagtggaggacagcctcgtttctaagcttgaaggcata
gaaggcgttgcgtccgtccaagtatcaggccagcaggtggaagaggttgaattctctttc
aaagaagacaaactgaaggaatacggccttgatgaagatacagtcaagcaagtgattcaa
ggttcagatgtgacaactccgcttggattgtacacattcggaaatgaagaaaaatctgtc
gtcgtcagcggcgatattgaaacaattaaagatttgaagaatatgagaatcccgacggca
tctgcttcaagtgcaggcagcagcgcagcatctcaagcaggtgcgcagagtgctcaagca
gcccaaagcgcgcaagcggcagcacaggtgcagcaaagcgcaagcacagcagtgccgacg
gtcaagctttctgacattgctacaattaaagatgtgaaaaaagctgaatccgtttcacgc
acaaatggcaaagacagcatcggcatcaacatcgtcaaagcaaacgatgcgaatacggta
gaggttgccgacgatgtcaaagctgagctgaaaaagttcaaagaagaccataaaggcttc
aattacagcgcaactctcgacatggcggagccgatcacacagtcagttgacacgatgtta
agcaaagccatcttcggtgctatttttgcgattgtgattattctcttattcttaagagat
atcaaatcaacattaatttctgttgtttcaattccattatcattgctgatcgcactcctt
gtgctgcagcagcttgatatcacattgaatattatgacgctcggcgcaatgaccgttgcc
atcggacgtgtagtcgatgactccatcgttgtgatcgagaacatttaccgccgcatgaga
ctcaaagatgagccgctccgcggaaaagccttggttcgtgaagcgacgaaggaaatgttt
aaaccgatcatgtcatcaacgattgtgacaatcgcggtattcctgccgctcgcacttgta
ggcggacaaatcggtgaattgtttattccatttgccttaacgattgtttttgcgcttgcc
gcatccctagtgatttcaatcacgcttgtgccgatgctcgcacacagcctgttcaaaaaa
tcattaaccggtgcgccgattaaagcgaaagaacacaaacctggcagacttgcaaacatc
tataaaaaagtattgaactgggcgctgagccacaaatggatcacgtctatcatcgcggtt
ctgatgctccttggaagcttgttcctcgtaccgttaatcggtgccagctacctgccgtcc
gaggaagaaaaaacgatgcagctcacatacagcccagaaccgggtgaaacgaaaaaagaa
gccgaaaatgaagctgaaaaagcggaaaaaatcctgcttgaccgcaagcatgtcgatacg
gttcagtattcattaggctctggcagcccgcttgccggaggagattctaacggtgcgtta
ttctatatcaaatatgaaagcgacacacctgactttgataaagaaaaagataacgttctg
aaggaaatccaaaagcaatctgaccgcggagaatggaagtcacaggacttcagctcttca
ggcaataataacgaattaacatactatgtgtatggcgattctgaaaacgatattaaagac
acggtcaaagacattgaaaaaatcatgaaagatgaaaaggatctgaaaaacgtaaattca
ggcctttccagcacatatgatgagtacacatttgtcgctgaccaagaaaaactaagcaag
ctcggtttaaccgcgtctcaaatttctcaggccttaatgtcacaaacatcgcaagaaccg
ctcaccactgtgaaaaaagacggcaaagagcttgatgtgaacattaagacagaaaaagac
gagtataagagtgtgaaagatttagagaataaaaagatcacttccgcgactggccaggaa
gtcaaaatcggcgatgtggcaaaagtgaaagaaggatcaacatcagataccgtgtcaaaa
cgtgacggaaaagtctatgcagatgtcacaggtgaggttacctctgacaacgtcacagcc
gtatcagctgctatccagaagaaaatcgataagcttgaccaccctgataacgtatcgatt
gacacaggcggcgtatcagcggatatcgctgattccttcacgaagctcggtttagcgatg
ctggcagcaatagcgatcgtttaccttgtgctcgtgattaccttcggcggagcactagcg
ccatttgcgattctgttctcattgccgttcacagtcatcggtgccctggtcggactttac
gtatcaggtgaaacgatcagtctgaacgccatgatcggtatgctcatgctgatcggtatc
gttgtcacgaatgccattgtcttaattgaccgcgtgattcataaggaagcggaaggcctg
tctacgagagaagcgctcctggaagccggctctacacgactccgtccgatcctgatgaca
gccattgcgacaatcggcgccttgattccattagccctcggcttcgaaggcggaagccag
gtcatttcaaaaggactcggcgtaacggttatcggcggtttaatcagttcaacgcttctg
acgctcctgatcgtgccaatcgtatatgaagtattggcgaagttccgcaagaaaaaaccg
ggaacggaagaagagtaa

DBGET integrated database retrieval system