KEGG   Bacillus subtilis subsp. subtilis 168: BSU06720
Entry
BSU06720          CDS       T00010                                 

Gene name
yerQ
Definition
(RefSeq) diacylglycerol kinase
  KO
K07029  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00561  Glycerolipid metabolism
bsu00564  Glycerophospholipid metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BSU06720 (yerQ)
   00564 Glycerophospholipid metabolism
    BSU06720 (yerQ)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     BSU06720 (yerQ)
SSDB
Motif
Pfam: DAGK_cat YegS_C NAD_kinase Fe-ADH_2
Other DBs
NCBI-GeneID: 936061
NCBI-ProteinID: NP_388554
Pasteur: BG12843
BSORF: BG12843
UniProt: O31502 A0A6M3Z8A9
Position
736436..737347
AA seq 303 aa
MKRARIIYNPTSGREIFKKHLAQVLQKFEQAGYETSTHATTCAGDATHAAKEAALREFDL
IIAAGGDGTINEVVNGLAPLDNRPTLGVIPVGTTNDFARALGIPREDILKAADTVINGVA
RPIDIGQVNGQYFINIAGGGRLTELTYDVPSKLKTMLGQLAYYLKGMEMLPSLRPTEVEI
EYDGKLFQGEIMLFLVTLTNSVGGFEKLAPDSSLNDGMFDLMILKKANLAEFIRVATMAL
RGEHINDQHIIYTKANRVKVNVSEKMQLNLDGEYGGMLPGEFVNLYRHIHVVMPKEKAEQ
LDD
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaaacgtgcacgcataatatacaatccgacttcaggacgggagatctttaaaaagcat
cttgcccaggtcctgcaaaaatttgaacaagccggctatgaaacctccacccatgcgacg
acatgcgcaggagacgctacacacgctgccaaggaagcggcattgcgtgagtttgacctg
atcattgcggcaggcggagacggaacgatcaacgaggtcgtcaacgggcttgcgccttta
gacaatcgtccgacactcggtgtgattcctgtcggcacaacgaacgacttcgccagagcg
ctcggaatcccacgcgaggatattttaaaagcggcagatacggtcattaacggcgttgcc
cgcccgattgatatcggacaggtcaacggccagtattttatcaatatcgccggcggaggc
cgtctgacggagctgacgtacgacgtgccaagcaaactgaaaacaatgctcggccagctt
gcttattatttaaaaggaatggaaatgctgccttcacttcgtccgacagaagtcgagatt
gaatatgacggcaagctgtttcaaggtgaaatcatgctgtttttggtcacgctgacaaac
tccgtcggcgggttcgaaaagctcgcgccggattccagcctgaatgacggcatgtttgat
ttgatgatactaaagaaagcaaaccttgctgaatttatcagggtcgccacgatggcgctt
cgcggagaacacatcaacgaccagcacattatttatacaaaagcgaaccgcgtgaaagtc
aatgtatcagaaaagatgcagctgaacctggacggcgagtacggcggcatgctgccgggc
gaattcgtgaatctgtaccggcacattcacgtcgtcatgccgaaggagaaagcggaacag
ttggatgactaa

DBGET integrated database retrieval system