KEGG   Bacillus subtilis subsp. subtilis 168: BSU06730
Entry
BSU06730          CDS       T00010                                 

Symbol
yefA
Name
(RefSeq) 23S rRNA (uracil-C(5))-methyltransferase RlmCD
  KO
K03215  23S rRNA (uracil1939-C5)-methyltransferase [EC:2.1.1.190]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU06730 (yefA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.190  23S rRNA (uracil1939-C5)-methyltransferase
     BSU06730 (yefA)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BSU06730 (yefA)
SSDB
Motif
Pfam: tRNA_U5-meth_tr TRAM Methyltransf_31 Methyltransf_25 Met_10 PrmA MTS Methyltransf_15 Methyltransf_11 RrnaAD Cons_hypoth95 Methyltransf_32 Methyltransf_23 TPMT N6_N4_Mtase Ubie_methyltran Methyltransf_12 PCMT 2-ph_phosp
Other DBs
NCBI-GeneID: 936060
NCBI-ProteinID: NP_388555
Pasteur: BG12826
BSORF: BG12826
UniProt: O31503 A0A6M3Z867
Position
737603..738982
AA seq 459 aa
MKMKPPVEKNEYYDVTFEDLTHEGAGVAKVQGFPIFVPNALPEEKAQIKVTRVKKGFAFG
RLIELKEESPHRTDAPCPIYKQCGGCQLQHMTYEGQLLFKQKQVKDVLERIGKLDLSKVT
VHPTLGMEDPWNYRNKAQVPVGEREGGLVAGFYQQRSHDIIDMSACLIQQSKNDEAVQAV
KDICANYGVKAYNEERHKGWLRHIMVRYGVVTGEMMIVFITRTSDFPHKAKIIEDITAQF
PHVKSIVQNINPNKTNVIFGNETNVIWGEEYIYDLIGDVKFAISARSFYQVNPEQTKVLY
DKALEYAELQGEETVIDAYCGIGTISLFLAKQAKKVYGVEIVPEAIEDAKRNAELNGNTN
AEFAVGEAETVIPKWYEEGITADTLVVDPPRKGCDEALLRTIVEMKPKRVVYVSCNPGTL
ARDLRVLEDGGYVTREVQPVDMFPHTNHVECCVLIKLKE
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgaaaatgaaacccccagtagaaaaaaatgaatactacgatgtgacatttgaggatttg
acacatgaaggagcgggcgtcgcaaaggtccaaggcttcccgatctttgtgccgaatgcc
ctacccgaggaaaaagcccaaatcaaagtgacacgcgtcaaaaaagggttcgccttcggc
cgcctgattgagctgaaggaagaaagcccgcatagaacggacgccccatgcccgatttac
aaacaatgcggaggctgccagcttcagcacatgacctacgaaggccagctcctgtttaaa
cagaaacaagtcaaagacgtcttagaacgcatcggcaagctggacctttcaaaagtcacc
gtgcacccgacactcggcatggaagacccgtggaactacagaaacaaagcacaggtgccg
gtaggagaacgggaaggcggactcgtcgcgggattctatcagcaaagaagccatgacatc
atcgacatgagcgcctgcctgatccagcaatccaaaaacgacgaagccgttcaagctgtc
aaagacatttgcgcaaactacggtgtcaaagcctacaacgaagaacgccacaaaggctgg
ctccgccacatcatggtcagatacggcgttgttacgggcgaaatgatgatcgtcttcatc
acaagaacaagcgacttcccgcacaaagcgaagatcatcgaagacatcacagcgcaattc
ccgcacgtcaaatccatcgtgcaaaacatcaacccaaacaaaacaaacgtcatttttggc
aacgaaacaaacgtcatctggggcgaagaatacatctacgacctcatcggagacgtcaaa
ttcgccatctccgccagatcgttttatcaggtcaacccagagcaaacaaaagtgctctac
gacaaagcgcttgagtacgctgagcttcaaggggaagaaaccgtcatcgacgcttactgc
ggcatcggaacgatttctctcttcctggcaaagcaggcgaaaaaagtgtacggtgtagag
attgtgccggaagcaattgaggacgcgaagcgaaacgccgaattaaacggcaacacaaac
gcagagtttgctgttggagaagcggaaaccgtgattccaaagtggtacgaagaaggcatt
acagctgatacgctggtcgtcgacccgccaagaaaaggctgcgacgaagccctcctgcgg
acaattgtggagatgaagccgaagcgggtagtgtatgtgtcctgtaatcctggcacgctt
gcgagagatttgcgggtgcttgaggatggcgggtacgtgacgcgcgaagtgcagcctgtg
gatatgtttccgcatacgaatcatgtggagtgctgtgtgttgataaaattaaaagaataa

DBGET integrated database retrieval system