KEGG   Bacillus subtilis subsp. subtilis 168: BSU06740
Entry
BSU06740          CDS       T00010                                 

Symbol
yefB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Recombinase Zn_ribbon_recom DUF4368 CdvA
Other DBs
NCBI-GeneID: 938745
NCBI-ProteinID: NP_388556
Pasteur: BG12827
BSORF: BG12827
UniProt: O34574
Position
complement(738995..739897)
AA seq 300 aa
MYNEGVTSPSQLARKKNATDKWHGSSIRKILENPHYTGTLQQCREYRPSVTSKRRRSVNL
ENQIIIEKSHEPIIPLEDFLIVQEILITRKRRRPQAEVHLFTNTAVCKDCRRSMHFKKNR
KGYVCGSYNKHGLKACSDHYVSEIDLTDKVITNLNKIYLKFSKENYFKELSEKALKYKEK
IESKIIEINEKLNDKKRDKSNLVISLANGVISKEDYQLAINITNEDISNFETTLHQLSKD
LEFQKIEKEIIDFKKSLDKFMKEGTLTPEMLHLLVDEIEVHANGTIEINYRFREPTVPSA
NT seq 903 nt   +upstreamnt  +downstreamnt
ttgtataacgaaggggtcactagtccctcgcagcttgcccgcaaaaagaacgctactgac
aaatggcacggatcttcaataagaaaaattctcgaaaatcctcactatactgggacacta
caacaatgtagagaatatagaccgagtgttaccagtaaaagaagaaggtcagttaaccta
gaaaaccaaataattattgaaaaaagccacgaaccaatcatacctttagaagactttctt
attgtacaagagattttaataactagaaaaagaaggagacctcaagctgaagtacatctc
tttacaaatactgcggtttgcaaagattgcaggaggtcaatgcattttaaaaagaatcga
aaaggttatgtttgtggaagttataataaacatggtttaaaagcatgtagtgatcattac
gtaagtgaaatagatttaactgataaagtaataaccaacctaaataagatatatttgaaa
ttcagtaaggaaaattattttaaagaattaagtgaaaaagcgttaaagtacaaagaaaaa
atcgaatctaagataatcgaaattaatgaaaaattaaacgataaaaagagagataaatcc
aatttagttatctctcttgctaatggtgttatatctaaagaagattaccaattagccata
aatatcaccaatgaagatatttcaaattttgaaactacccttcaccaactatctaaggac
ctagaatttcaaaagattgaaaaagaaataattgattttaaaaagagcttagataaattc
atgaaggaaggtacacttacccccgaaatgcttcatttgttagtagatgaaatagaagta
catgcaaatggaaccattgaaatcaattatcgttttagagaaccaacagttccatcagca
tag

DBGET integrated database retrieval system