KEGG   Bacillus subtilis subsp. subtilis 168: BSU06750
Entry
BSU06750          CDS       T00010                                 

Symbol
yefC
Name
(RefSeq) resolvase YefC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_49 Resolvase HTH_7 Trp_repressor SMYLE_N HTH_32
Other DBs
NCBI-GeneID: 938743
NCBI-ProteinID: NP_388557
Pasteur: BG12828
BSORF: BG12828
UniProt: O35034
Position
739878..740213
AA seq 111 aa
MTPSLYNPLAIASKPFPAIYSEKILIFTIFSAFAEFERDMIVERTQEGKMLAKQNPDFRE
GRPKKFTKQQINHALTLLENHSYKQVEDMTGISVSTLVRAKKKKAAEAING
NT seq 336 nt   +upstreamnt  +downstreamnt
gtgaccccttcgttatacaatccccttgctattgcatcaaagccttttccagcaatatat
tctgaaaagattctaatatttactattttctctgcgtttgctgaatttgagagagatatg
attgtagaacgaactcaagaaggtaaaatgttggccaagcagaatccggatttccgagaa
ggaagacccaaaaagttcacaaagcagcaaatcaatcatgcattaacattactagaaaat
cattcgtataaacaagttgaagatatgactgggatatcagtttctacacttgtaagagct
aaaaagaagaaagctgctgaagctataaatggataa

DBGET integrated database retrieval system