KEGG   Bacillus subtilis subsp. subtilis 168: BSU06780
Entry
BSU06780          CDS       T00010                                 

Symbol
yeeC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: T5orf172 MUG113
Other DBs
NCBI-GeneID: 936062
NCBI-ProteinID: NP_388560
Pasteur: BG12820
BSORF: BG12820
UniProt: O34352 A0A6M3Z8T3
Position
744851..745999
AA seq 382 aa
MASNRYHSINEIMESQLFYQITTPPKKTQKAQYDPEVEKFLEIIEFVKENGREPQKVPTD
LTERSLASRLIGIRKDPDRMEYLKEYDEIGLLEVRSKELTIPKISSIDDILKSGLSALLG
DNLNNDITRSIFDTSSLQKVTTMPEYVAKRKKIKDFGKFEELFKKCHKEITEGKRKILTF
KNEQDIQSNSFYILKGVLLYVEDVGERKKAKGKTNARLRCIFENGTESDMLLRSLSAELY
KHGRRVTDNEDTLLDNVREDDVSTGFIYVLKSLSTDPQISSIKNLYKIGFTTGSVENRIR
NAENQSTYLYAPVEIVTTYQVFNMNASKFETAIHHALANNNLDVSILGANGKMLVPKEWF
VVTLEDLQAVIDEIVMMVHLYD
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggcaagtaatagataccattctattaatgaaatcatggaaagtcagctgttttaccaa
atcacaacaccacctaagaaaacacaaaaagcccagtatgatcctgaagttgaaaagttt
ttggagattattgaattcgtcaaagaaaatgggcgagaaccccaaaaagtccctactgat
ttaactgaaagaagtttagcaagtcgattaattgggattcggaaagatcctgatcgtatg
gaatatttgaaagagtatgatgaaattggattacttgaagtaagatcgaaggaactaaca
attcctaaaatttcttcaattgatgatattctaaaaagtggcttatctgcattattaggt
gataatttaaataatgatataactaggtcaatttttgatacaagttcacttcaaaaggtt
acgacaatgcctgaatacgttgcaaagcgtaaaaaaataaaagattttggaaagtttgaa
gagctattcaagaagtgccacaaggaaattacagagggtaaacgaaaaattttaactttc
aaaaatgaacaagacatacagtcaaatagtttttatatattaaaaggagttcttctttat
gttgaagatgtgggagaacgtaaaaaagcaaagggaaaaaccaatgctagacttcgatgt
atatttgaaaatggaacggaatcagatatgttactacgttccttatcagcggagttatat
aaacatggtagacgtgtgaccgacaatgaagatacattgttggataatgttagagaagat
gatgtttcgactggctttatttacgtactaaaatctttgagtacagatccgcaaattagt
tccattaagaatttatataagatcggttttacaactggttcagtagaaaatagaatcagg
aatgcagaaaatcaatcaacttatctttatgctccagtagaaattgtaaccacatatcaa
gtgttcaatatgaatgctagcaaatttgagacggcaatccatcatgcgctagcaaataat
aatttggatgtttctattttgggggcaaatggaaagatgttagttcctaaagagtggttc
gttgtcacacttgaagatttacaagctgtaatagatgagattgtgatgatggttcatctt
tatgactaa

DBGET integrated database retrieval system