KEGG   Bacillus subtilis subsp. subtilis 168: BSU06790
Entry
BSU06790          CDS       T00010                                 

Symbol
yeeD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5344
Other DBs
NCBI-GeneID: 938755
NCBI-ProteinID: NP_388561
Pasteur: BG12821
BSORF: BG12821
UniProt: O34950 A0A6M4JG52
Position
complement(746261..746566)
AA seq 101 aa
MTVRKELIKQINLTITVIKTINQKNPTPMVKNILKRYEEAKEFILQSSDGKFEEDLSKVR
NKLDTLTRAYLESANDYMNPMLKEMHKTEKLLKEYDETTQS
NT seq 306 nt   +upstreamnt  +downstreamnt
ttgacagtaagaaaagaattaataaaacaaataaatttaacaatcactgtaataaaaaca
ataaatcaaaagaatccaactccaatggtgaaaaacatattaaaaagatatgaagaggca
aaagaatttatccttcaatcatcggatggaaaattcgaagaagacctctctaaagttaga
aataaactagacactctgacgagagcatatctagaatcagctaacgactacatgaatccg
atgctcaaagaaatgcataagacagaaaaactgctaaaagagtatgacgaaactactcag
tcgtaa

DBGET integrated database retrieval system