KEGG   Bacillus subtilis subsp. subtilis 168: BSU06800
Entry
BSU06800          CDS       T00010                                 

Symbol
yezA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Colicin_Pyocin
Other DBs
NCBI-GeneID: 938751
NCBI-ProteinID: NP_388562
Pasteur: BG12872
BSORF: BG12872
UniProt: O31505 A0A6M3Z874
Position
complement(746633..746839)
AA seq 68 aa
MDKLTKEELIFLVKELMNPTLDDEKVSEYLDLLEKNVPYPAPSDLIFWSNEDYTAEQVVK
IALNYKDE
NT seq 207 nt   +upstreamnt  +downstreamnt
atggataaactgacaaaagaagagttgatctttcttgtaaaggaattaatgaacccaaca
ttagatgatgagaaagtcagtgaatatctcgatttattagagaaaaatgttccttatccg
gcaccaagtgatttaattttctggagcaatgaagattacacagcggaacaagttgtaaaa
attgctctaaattataaagatgagtag

DBGET integrated database retrieval system