KEGG   Bacillus subtilis subsp. subtilis 168: BSU06811
Entry
BSU06811          CDS       T00010                                 

Symbol
yezG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF600 CBP4 Pox_H7
Other DBs
NCBI-GeneID: 8303066
NCBI-ProteinID: YP_003097692
UniProt: C0H3X4 A0A6M4JRA8
Position
complement(747079..747534)
AA seq 151 aa
MQDLYQLIGEKLNDIIPGEWTKIYLYAEVLDDSTMVLFHFRTPENNQIIYSQDIPSHYNV
SKDIFKTLLRELRELFEELRTEHRNNNDDVWTNLTLTLDRSGEFQLDYNYDDILASELDG
YERIAIWEYKNLGILPEDEDDKEFVISYLGL
NT seq 456 nt   +upstreamnt  +downstreamnt
atgcaagatttgtatcaacttattggagaaaaactcaatgacatcatacctggtgaatgg
acaaagatatatctttatgcagaagtattagatgattccacaatggttctttttcatttc
agaacaccagaaaataatcaaattatttattcacaagatatacctagccattacaacgta
agcaaggatattttcaagacgttgttaagagaactaagagaactttttgaagaattaaga
actgaacacagaaataataacgatgatgtttggactaaccttacactaacattggatcgt
agcggagaattccaattagattataattatgatgatattttagcctcagaattagatgga
tatgaaagaatcgcaatatgggaatataaaaaccttggtattttgcctgaagatgaggat
gataaagaatttgtaattagttacctcggtctataa

DBGET integrated database retrieval system