KEGG   Bacillus subtilis subsp. subtilis 168: BSU06812
Entry
BSU06812          CDS       T00010                                 

Symbol
yeeF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: LXG Endonuclea_NS_2
Other DBs
NCBI-GeneID: 938753
NCBI-ProteinID: NP_388563
UniProt: O31506 A0A6M3Z837
Position
complement(747554..749563)
AA seq 669 aa
MKVFEAKTLLSEATDRAKEYKELRTQMVNLRKALKGVADLSDSEFSGKGASNIKAFYHDH
VGVADQWIDYIDMKIAFFNSIAGAAEDKGLSDAYIEESFLEHELANANKKSKSIMSEQKK
AMKDILNDIDDILPLDLFSTETFKDELADANDKRKKTLEKLDALDEDLKTEYALSEPNEQ
FIKSDFQKLQEATGKGKNATPIHYNAKAYRESDIHKKKGDIEKRTEAYLKIKKEEAKERE
IEKLKERLKNYDYADADEFYEMAKTIGYENLTAEQQRYFTQIENTRELEAGFKGVAVGLY
DSGKDAVVGLWDMVTDPGGTVEAITGAMAHPIKTYEAISAAIEESYQKDMVNGDTYSRAR
WVSYAVGTVVTSIVGTKGVGAVSKTGTAAKVTTKVKTAASKSATAQKAITVSKQTVDHIK
QKVNTGIEVSKKHVKTKLNQIGDLTLADILPYHPRHDLVPAGVPYNAVNGVTLKEGLQKF
AKVILPKPYGTSSSGRRTPAPHVPPVTVKYGEHFARWSRKKVLKPNIIYKTKEGYTYTTD
NYGRITSVKADLQLGEAKRNQYAQTNAGKPQDRKPDDDGGHLIATQFKGSGQFDNIVPMN
SQINRSGGKWYEMEQEWAKALSKKPPKKVAVQIEPVYSGDSLRPSYFDVTYKIGSRKEIS
VSIKNQPGG
NT seq 2010 nt   +upstreamnt  +downstreamnt
atgaaagtatttgaagcgaaaacactgctttcggaagcgacagaccgtgcaaaagagtac
aaagaactaagaacgcaaatggtcaacttgagaaaagcgttaaaaggagtcgctgatctc
agtgacagtgaattctcaggaaaaggcgccagcaacatcaaggcattctatcacgaccac
gtcggcgtcgccgaccagtggatcgactacatcgacatgaaaatcgcatttttcaacagc
atcgccggagccgccgaagacaaaggcctctcagacgcatacatcgaagaatccttcctg
gagcacgaactggcaaatgccaataaaaaatctaaatccatcatgtccgaacagaaaaaa
gcgatgaaagacatcctaaacgatatcgacgacatcctcccgctcgacctgttttcaaca
gaaaccttcaaagacgagctggccgatgccaacgacaaacgcaaaaaaacactggaaaaa
ttggacgccttggacgaagacctgaaaacagaatacgccctgtctgaaccaaacgaacaa
ttcatcaaatccgacttccaaaagctccaagaagcaacgggtaaaggcaaaaacgccaca
cccatccactacaacgccaaggcgtaccgtgagagtgacatacataagaaaaaaggcgac
attgaaaagcggactgaggcttacttgaagattaagaaagaggaagcgaaggaacgcgag
attgagaaactgaaagaaagactgaaaaactacgattatgcagatgccgatgaattctac
gaaatggcaaaaacgatcggctatgaaaatctgacagctgaacaacagagatacttcacc
caaattgaaaacacgcgtgagcttgaagcaggcttcaaaggggttgccgtcggcctttat
gattccgggaaagacgcggtcgtaggcctgtgggatatggtcacagatccgggaggaacc
gttgaagcgattaccggagcgatggctcacccgatcaaaacgtatgaagccatttcagcg
gcaatcgaagaatcgtatcaaaaagacatggtgaatggtgacacctactcaagagcaaga
tgggtgtcatatgcggttggcactgttgtcacatcaattgtcggcacaaaaggcgtagga
gccgtctcaaaaactggcacagccgccaaagtgacgaccaaagtcaaaacagcagcaagc
aaatcagcaacagcccaaaaagccataacagtctcaaaacaaaccgttgatcacatcaaa
caaaaagtaaacacaggcattgaagtatcaaaaaaacacgtcaaaaccaagttaaatcaa
atcggagatctcacacttgcggatattctcccgtatcatccccgtcatgatttagtgccg
gcaggcgttccttacaacgcagtcaacggggtcacgcttaaagaaggactgcaaaaattc
gccaaggtcatcctgccgaaaccatacggaacgtcatcaagcggaagacgaactccagcg
ccacatgtaccgccggtaaccgtcaaatacggcgagcatttcgcaagatggagcagaaag
aaagtgctgaagcctaatatcatctacaaaacaaaagaaggctacacgtacacgactgac
aactatggtagaattacaagtgtcaaagcagacttgcagctgggagaagcgaaacgaaac
caatatgcacaaacgaatgctggaaagccccaggaccgaaagcctgacgatgacggcggc
catttaatcgccacccaattcaaaggctcaggccagtttgacaatatcgtgccgatgaat
tctcagattaataggagcggtgggaaatggtatgagatggagcaggagtgggcaaaagcc
ctaagcaaaaaaccacctaaaaaagtagcagttcaaatagaaccagtctattctggggat
tcacttagaccatcatatttcgatgtaacctacaaaattgggagcagaaaagaaataagc
gtctctattaaaaatcagcctgggggttag

DBGET integrated database retrieval system