KEGG   Bacillus subtilis subsp. subtilis 168: BSU06820
Entry
BSU06820          CDS       T00010                                 

Gene name
yeeG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SGL
Other DBs
NCBI-GeneID: 938041
NCBI-ProteinID: NP_388564
Pasteur: BG12823
BSORF: BG12823
UniProt: O31507 A0A6M4JE22
Position
749775..750797
AA seq 340 aa
MTKKRITFGLLVLMVCVILFVLYVQLRNKDSIPVQSSAIHPEEDRIFFIYSNPFIKESVL
LSTSTGERFNRRTFKVADVPYIQTKSYASTDLVLLAEHEPFYYTLEKDVIKEHPLSDPFA
FWYEGKDVTIEAYNVDTTGNEIHINDRKTKKEYTLTLPPLVTMGASDENFIYIIQSMSIY
VIDRKTEEMIETLSLASYADQFADSEEFIVASSDHKLTVIEKGTWKTTYIAYPEDLEYAD
TVYYDKESGSFYVAYEDKEGGANLLEYGEDFSIHTYSLKFPYMEAKFKGNLLYIVAQEEH
KKGIGGYVGVFDIHSKEMLYQFDLPEEQVKVQDFVVVDNK
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgacgaaaaaacggattacatttggtttattagttttaatggtatgtgtcatcctgttt
gttctgtatgttcagttacgcaataaagatagtattcctgtccaatcttccgccattcac
cccgaagaagaccgcatcttttttatttactccaatcctttcataaaagaaagcgtgctg
ctttcaacctctacaggcgaacggtttaacaggcgtacgtttaaggtggcggatgtgcct
tatattcaaacgaaatcttatgcatcaacagaccttgtattattggcggaacacgagcct
ttttactacacgctggagaaggatgtgatcaaagagcatccgctgtcagatccatttgcg
ttttggtatgaggggaaggatgtcactattgaggcctataatgttgatacgacgggaaat
gagatccacataaacgacagaaaaacgaaaaaggaatatacccttaccttgcctccgctt
gtcacaatgggggccagtgatgagaactttatttatatcattcaaagcatgtctatttac
gtgattgacagaaaaacagaggaaatgattgagaccctgagcttagcctcatacgctgat
caattcgcagactcggaggaatttatcgtcgcgagctcggatcataaattgactgtgatt
gaaaaagggacatggaagacgacatatattgcgtatcctgaagatcttgaatatgcagat
actgtgtactatgacaaagaaagcggcagtttttacgtggcgtacgaggacaaagagggt
ggagcgaacttgctggaatatggggaggatttttctattcacacatacagcttgaaattc
ccttatatggaggcgaagtttaaggggaatctattgtatatagttgcccaggaagagcat
aaaaagggcatcggcggatacgtgggtgtgtttgatatccattctaaggagatgctttat
cagtttgatttgcctgaggaacaggtgaaggttcaggattttgttgtggttgacaataag
tga

DBGET integrated database retrieval system