KEGG   Bacillus subtilis subsp. subtilis 168: BSU06840
Entry
BSU06840          CDS       T00010                                 

Symbol
yeeI
Name
(RefSeq) transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Transcrip_reg NapD
Other DBs
NCBI-GeneID: 938749
NCBI-ProteinID: NP_388566
Pasteur: BG12824
BSORF: BG12824
UniProt: O31509 A0A6M3ZBG7
Position
752412..753131
AA seq 239 aa
MGRKWNNIKEKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALKVVLERAKTYSVP
KNIIERAIEKAKGGAEENYDELRYEGFGPNGSMIIVDALTNNVNRTAPEVRAAFGKNGGN
MGVSGSVAYMFDATAVIGVEGKTADEALEILMEADVDVRDILEEDDSAIVYAEPDQFHAV
QEAFKNAGVEEFTVAELTMLAQSEVTLPDDAKEQFEKLIDALEDLEDVQQVYHNVDLGE
NT seq 720 nt   +upstreamnt  +downstreamnt
atgggccgtaagtggaacaatattaaagagaagaaggcgtctaaggacgcaaatacgagt
cggatttatgcgaagtttggccgtgagatttatgtggcggcgaaacagggcgagcctgat
ccggaatccaaccaggcgctgaaggttgtgcttgaacgtgcgaagacttacagcgtgccg
aaaaacatcattgaacgtgcgatcgagaaggcgaagggcggagcggaagagaattacgat
gagcttcgttatgagggcttcgggccgaacggatcaatgattatcgttgatgcgctgacg
aataatgtaaaccgtacggcgccggaagtgcgtgcggcgttcgggaaaaacggcggaaac
atgggtgtgagcggatctgttgcttacatgtttgacgcgacggctgtaatcggtgtggaa
ggcaaaacggctgacgaagcgcttgaaatcctgatggaagcggatgttgatgtacgtgac
attttagaagaggatgacagcgcgatcgtgtatgccgagcctgatcaattccatgcggtg
caagaggcgtttaaaaacgcgggtgtcgaggaatttacagtagcggagctgacaatgctt
gcgcaaagtgaagtaacgcttccggatgatgcaaaggaacagtttgaaaaattgattgat
gcattagaagatttggaagatgttcagcaggtatatcataacgttgatttaggtgagtaa

DBGET integrated database retrieval system