KEGG   Bacillus subtilis subsp. subtilis 168: BSU06860
Entry
BSU06860          CDS       T00010                                 

Gene name
yezE
Definition
(RefSeq) TetR family transcriptional regulator
  KO
K16137  TetR/AcrR family transcriptional regulator, transcriptional repressor for nem operon
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU06860 (yezE)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   TetR/AcrR family
    BSU06860 (yezE)
SSDB
Motif
Pfam: TetR_N TetR_C_11 TetR_C_7 HTH_Tnp_1_2
Other DBs
NCBI-GeneID: 2914263
NCBI-ProteinID: YP_054572
Pasteur: BG14194
BSORF: BG14194
UniProt: Q7WY76 A0A6M3ZDI4
Position
753817..754401
AA seq 194 aa
MGRNKEFDTALVLHRAIEVFGEYGYEGTSLQDLLSHLGIARQSLYDTYGTKRDLFLSAVK
SYLEGKNAAVMERLEAPGSVKEAIRDIFQEGVNALRDPERAKACYIINSAIEQIPHDPEL
ARYFERQSKQLEDAFYHGLLRAKDQGELNGEDTDISALARYLNQSRLSLTFIAKVTADMD
RLQDHVDVSLSVLD
NT seq 585 nt   +upstreamnt  +downstreamnt
ttggggaggaataaagaatttgatacggcgcttgttcttcacagggcgatagaggttttt
ggagagtatggctacgaaggaacgtctcttcaggatctgctctctcatttaggcattgcg
cgccaaagtttgtatgatacgtatggaacgaagcgtgatttgtttttgtccgctgtgaaa
tcgtatcttgaagggaaaaacgctgccgttatggaaaggcttgaagcgccaggatctgta
aaggaagccattcgtgatatttttcaggagggtgtcaatgccctgagggatccggaacgg
gcgaaggcgtgctacattattaacagcgcgattgaacagatcccgcatgaccctgagctt
gcccggtattttgaaagacaatccaagcagcttgaggacgctttttatcacgggctttta
agagcgaaggatcaaggagaattgaatggcgaagatactgatatatctgcgcttgctcgg
tacctgaatcagagcaggctgtcactgacatttattgcaaaagtgacggcagatatggat
cggcttcaggaccatgttgacgtgagtttatcagtgcttgattaa

DBGET integrated database retrieval system