KEGG   Bacillus subtilis subsp. subtilis 168: BSU06870
Entry
BSU06870          CDS       T00010                                 

Gene name
yesE
Definition
(RefSeq) hypothetical protein
  KO
K06893  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU06870 (yesE)
SSDB
Motif
Pfam: SnoaL_2 LEH PHZA_PHZB SnoaL_4 SnoaL DUF4440 NTF2
Other DBs
NCBI-GeneID: 936064
NCBI-ProteinID: NP_388568
Pasteur: BG12844
BSORF: BG12844
UniProt: O31511 A0A6M3Z8T7
Structure
PDB: 
1S5A

Position
754480..754923
AA seq 147 aa
MLMNEFEKACETLRKFMAYMLEKDMKSWTELWDENAVFEFPYAPEGSPKRIEGKAAIYDY
IKDYPKQIHLSSFTAPTVYRSADSNTVIAEFQCDGHVIETGLPYRQSYISVIETRDGRIV
RYRDYWNPLVVKEAFGGSFLQTEESGK
NT seq 444 nt   +upstreamnt  +downstreamnt
atgttgatgaatgagtttgaaaaagcatgtgaaacattgagaaagtttatggcttatatg
cttgagaaggacatgaagagctggacggagctttgggatgagaatgctgtatttgagttt
ccttatgcgccggagggatcaccaaaaagaatagaaggaaaagcggccatttacgattat
attaaagattatcctaagcagattcatctttcttcatttaccgctccgacagtgtaccgt
tcagcagactcgaatacggtgattgcggagtttcaatgtgacggccatgtgattgagact
ggactgccttatcgccaaagctatatcagtgtcatcgaaacgagagacggccgcattgtg
cgttatagggattattggaatccgcttgttgtaaaagaggcctttggaggatcatttttg
caaacagaggagagtgggaaatga

DBGET integrated database retrieval system