KEGG   Bacillus subtilis subsp. subtilis 168: BSU06880Help
Entry
BSU06880          CDS       T00010                                 

Gene name
yesF
Definition
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NmrA NAD_binding_10 Epimerase adh_short GDP_Man_Dehyd CoA_binding_2 F420_oxidored 3HCDH_N KR Polysacc_synt_2 2-Hacid_dh_C Radical_SAM
Motif
Other DBs
NCBI-GeneID: 936067
NCBI-ProteinID: NP_388569
Pasteur: BG11808
BSORF: BG11808
UniProt: O31512
Position
754920..755780
Genome map
AA seq 286 aa AA seqDB search
MMKQNPILITGGTGTVGSRIASRLIKLGYRVRIASRKKGALADAEYVYFNWKYASSFTPA
LEQVKQIYLVAPVGVFDPAPYVLPFLKEAKRLGAKRVVMQSASVVSENGPVFGALHQAVR
EFPEWTVLRPSYFMQNFINVQHRMSIQTEGRITTASGEGKLGFIDADDIAETAVRALIDD
VPHQTHHILTGPEALSYAEAAEIIGAAAGRRVEHVSISRSELQHKMEAGGLPADYAHFMA
KLDEAISHGAEHRVTDTVKRVTGKEPRSLSEFAAAHAAYWTSFWTE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacagaatccgattttaatcacgggcgggaccggcacagtcggcagccgaatc
gccagccgtttaataaagctgggatacagagtgcgtattgcaagccggaaaaagggcgcg
cttgctgatgctgagtatgtgtattttaattggaagtacgcctccagttttacgcctgct
ctggaacaggtaaaacagatctatcttgttgctccggtcggtgtatttgatccggctccc
tatgtgcttccctttttaaaggaagcaaagcgtctcggcgcaaagcgggtagtgatgcaa
agtgcgtctgttgtctccgagaacggtcccgtgtttggcgcgcttcaccaggcagtgcgc
gagtttccagaatggacggtgctgcggccctcatactttatgcaaaatttcatcaatgtc
cagcaccgcatgtctattcaaacggaggggcgcatcacaacggcttcgggtgaaggaaaa
cttgggtttattgacgctgatgacatcgcagaaacagccgtcagggctttgattgatgat
gttcctcatcaaacacatcatattctgacaggtcccgaggcgctgagctatgccgaagcg
gcggagatcattggagctgcggcgggacgccgggtggagcatgtcagcatttctcgttcc
gagctgcagcataaaatggaggcaggaggtttgcccgcggattatgcccattttatggcg
aagcttgatgaggcaattagccatggtgcggaacatcgggtaacggatacagtgaagcgt
gtgacgggaaaagaacctcgttcgctgtcagagtttgcggctgctcatgctgcatattgg
acctcattttggactgaatag

DBGET integrated database retrieval system