KEGG   Bacillus subtilis subsp. subtilis 168: BSU06890
Entry
BSU06890          CDS       T00010                                 

Symbol
cotJA
Name
(RefSeq) spore coat associated protein CotJA
  KO
K06332  spore coat protein JA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU06890 (cotJA)
SSDB
Motif
Pfam: CotJA
Other DBs
NCBI-GeneID: 938758
NCBI-ProteinID: NP_388570
Pasteur: BG11799
BSORF: BG11799
UniProt: Q45536 A0A6M4JFU6
Position
755907..756155
AA seq 82 aa
MKDMQPFTPVKSYTPFHSRFDPCPPIGKKYYRTPPNLYMTFQPEHMEQFSPMEALRKGTL
WKDLYDFYENPYRGGDAHGKKG
NT seq 249 nt   +upstreamnt  +downstreamnt
atgaaggatatgcagccgtttacgcctgtcaaatcatatacgccctttcacagccgtttt
gatccctgtccgcccatagggaagaaatattacagaacgccccctaacctttatatgacc
tttcagcctgagcacatggagcagttttcgccgatggaggctttgaggaaaggcaccctt
tggaaggatctctatgatttttatgaaaacccttatcgagggggagacgcacatggcaaa
aaaggttga

DBGET integrated database retrieval system