KEGG   Bacillus subtilis subsp. subtilis 168: BSU06900
Entry
BSU06900          CDS       T00010                                 

Symbol
cotJB
Name
(RefSeq) spore coat protein CotJB
  KO
K06333  spore coat protein JB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU06900 (cotJB)
SSDB
Motif
Pfam: CotJB DUF2987
Other DBs
NCBI-GeneID: 936071
NCBI-ProteinID: NP_388571
Pasteur: BG11800
BSORF: BG11800
UniProt: Q45537 A0A6M3Z846
Position
756139..756402
AA seq 87 aa
MAKKVDAEYYRQLEQIQAADFVLVELSLYLNTHPHDEDALKQFNQYSGYSRHLKRQFESS
YGPLLQFGNSPAGKDWDWGKGPWPWQV
NT seq 264 nt   +upstreamnt  +downstreamnt
atggcaaaaaaggttgacgccgaatattatcgtcagctagagcaaatacaggctgctgat
tttgtgcttgttgagctgagtctttatttaaatacacatcctcatgatgaagatgcgttg
aagcaattcaatcaatattccggctattcaaggcacttaaaaagacagttcgaatcctct
tacggaccgcttctgcagttcggcaacagccccgcgggcaaggattgggattggggaaaa
gggccatggccgtggcaagtataa

DBGET integrated database retrieval system