KEGG   Bacillus subtilis subsp. subtilis 168: BSU06910
Entry
BSU06910          CDS       T00010                                 

Gene name
cotJC
Definition
(RefSeq) spore coat peptide assembly protein CotJC
  KO
K06334  spore coat protein JC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU06910 (cotJC)
SSDB
Motif
Pfam: Mn_catalase Rubrerythrin
Other DBs
NCBI-GeneID: 938762
NCBI-ProteinID: NP_388572
Pasteur: BG11801
BSORF: BG11801
UniProt: Q45538 A0A6M4JE30
Position
756417..756986
AA seq 189 aa
MWVYEKKLQYPVKVSTCNPTLAKYLIEQYGGADGELAAALRYLNQRYTIPDKVIGLLTDI
GTEEFAHLEMIATMVYKLTKDATPEQLREAGLGDHYVNHDSALFYHNAAGVPFTASYIQA
KGDPIADLYEDIAAEEKARATYQWLIDISDDPDLNDSLRFLREREIVHSMRFREAVEILK
EERDKKKIF
NT seq 570 nt   +upstreamnt  +downstreamnt
atgtgggtgtatgaaaagaagctgcaataccctgtcaaggtcagtacgtgcaacccgacg
ctggcgaagtatttgattgagcagtatggcggagcggacggcgagctggccgcggctctc
cggtatttgaaccagcgttatacgattcctgataaggtcatcggccttttaacagatatc
ggcacggaggagtttgcccatttggaaatgattgcgaccatggtctataagttaacgaaa
gacgccacaccggagcagctgcgtgaagctgggcttggcgatcattacgtcaatcacgac
agcgcgcttttttatcataatgcggcgggcgtgccgtttaccgcgagctatatccaagcg
aagggcgatccgattgccgatttatacgaagatattgccgcagaagaaaaggcgcgggcg
acgtatcaatggctgattgatatttcggatgatcctgatttaaacgattccctgcgtttt
ttgcgtgagcgtgaaatcgtacactctatgcgcttcagagaagcggttgaaattttaaaa
gaagaacgggataaaaagaagattttctaa

DBGET integrated database retrieval system