KEGG   Bacillus subtilis subsp. subtilis 168: BSU06920
Entry
BSU06920          CDS       T00010                                 

Gene name
yesJ
Definition
(RefSeq) N-acetyltransferase YesJ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10
Other DBs
NCBI-GeneID: 936070
NCBI-ProteinID: NP_388573
Pasteur: BG11809
BSORF: BG11809
UniProt: O31513 A0A6M3Z8C1
Position
757111..757653
AA seq 180 aa
MTAFKIENETIADGFYACPAVYEDAESITGLLVRTAEWLRDRGSNQWSGLLKGQDIHDIT
GSIEKGHVFVFKKDEELAAVVMLLPAPSEWDRTLWGDDGHEESIYLHRLAVSRRFAGQGL
GARVLQWAETGIHFPEKTRIRLDCVADSDALHSFYRRMGYEFMGADASGYHLFEKEITAE
NT seq 543 nt   +upstreamnt  +downstreamnt
atgacagcttttaagattgagaacgaaacgattgcagatggattttacgcgtgtccggcc
gtctatgaggatgcagaatcgattaccgggttgctcgtccgaacagctgaatggctccgg
gatcggggttctaaccaatggagcggacttctcaaagggcaagatatacatgatatcacg
gggtcaattgaaaagggacatgtgtttgtgtttaaaaaagatgaagagcttgcggctgtc
gtgatgctgctgcctgcaccgagcgagtgggaccggacgctttggggagacgatgggcat
gaggagtccatttatttacaccgcctcgcagtaagccgccggtttgcgggacaggggctt
ggagcccgcgtccttcagtgggcggagacgggcatacactttccggaaaaaacgcggatc
cggcttgactgtgtcgctgatagtgacgccctgcattccttttatcggcgtatgggatat
gaattcatgggtgctgatgcgtccggatatcatttgtttgagaaagagattacggcagaa
taa

DBGET integrated database retrieval system