KEGG   Bacillus subtilis subsp. subtilis 168: BSU06930
Entry
BSU06930          CDS       T00010                                 

Symbol
yesK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YesK MerC FixP_N MASE5 DUF6044 ATP-synt_S1 ABC2_membrane_5 DUF1129 Peptidase_A8
Other DBs
NCBI-GeneID: 936069
NCBI-ProteinID: NP_388574
Pasteur: BG12845
BSORF: BG12845
UniProt: O31514 A0A6M4JJC4
Position
757676..757978
AA seq 100 aa
MSFSKREAGDVWSILFVTGIVTACLFAGVSVLMRMRFPDKSRPEWMLAGLIVLGVFAIWY
SLVYVRGWEGAALGMLGFNVIFGAIAGYLIDKAIRRYRKR
NT seq 303 nt   +upstreamnt  +downstreamnt
ttgtctttttctaaaagggaggcaggcgatgtgtggtcaatattatttgtgacagggatt
gtgacggcttgtctgtttgctggcgtatccgtattgatgcggatgagatttcctgacaaa
agtcggccggaatggatgttggccgggctgatcgtccttggtgtgtttgcgatctggtac
agcctcgtgtatgtacgcggctgggaaggggctgcgctcggaatgcttggattcaatgtc
attttcggagccattgccggatatttgatcgataaggccatccggcgttacaggaaaaga
taa

DBGET integrated database retrieval system