KEGG   Bacillus subtilis subsp. subtilis 168: BSU06940
Entry
BSU06940          CDS       T00010                                 

Symbol
yesL
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF624
Other DBs
NCBI-GeneID: 938754
NCBI-ProteinID: NP_388575
Pasteur: BG12846
BSORF: BG12846
UniProt: O31515 A0A6M4JDR6
Position
758093..758722
AA seq 209 aa
MLMIHSVANGLNHFCTWVMRLAYLNVLWILFSLAGLVVFGLMPATAAMFTVAREWAKGNT
DAPVFSVFFRTFKKEWRASQILGLIVVTAALFLFADMRIAAQMDQPVLVNVFVSISLIFA
FVVLYVFPVFSHFDVKIREVLSISFFIAFSRPAVTLLMAAGAVGVLCLVLFHVTFLLFFS
GSLLSLILTKLSFKAFRSMDQRQEKEKAA
NT seq 630 nt   +upstreamnt  +downstreamnt
atgttgatgatacacagtgtggcaaatgggctgaatcatttttgtacgtgggtgatgaga
ctggcctatttgaatgtgctttggattttgttttctcttgcaggcctggttgtatttggg
ctgatgcccgctactgccgcgatgtttacagtggcgagagaatgggcgaaggggaataca
gatgccccggtgttttctgtcttttttcggacgtttaaaaaggaatggcgggcatcacag
atcctcgggcttatcgttgtgacggctgccctgtttctgtttgcggatatgcggatagcg
gctcagatggaccagcctgtgctcgtcaatgtattcgtgagcattagtttgattttcgcg
tttgttgtgctgtatgtgttcccggtattttctcattttgacgtaaaaatcagagaggtg
ctgagcatcagctttttcattgccttcagtcgtccggcggtgacgcttttgatggcagcg
ggcgctgtcggtgtgctttgtctcgttctgtttcatgtcacgtttctattgtttttcagc
gggagtttactcagcctgatcttaacgaagctgtcctttaaagcgtttcggtcaatggat
cagcggcaggagaaagaaaaggcggcatga

DBGET integrated database retrieval system