KEGG   Bacillus subtilis subsp. subtilis 168: BSU06950
Entry
BSU06950          CDS       T00010                                 

Symbol
yesM
Name
(RefSeq) sensor histidine kinase
  KO
K07718  two-component system, sensor histidine kinase YesM [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU06950 (yesM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU06950 (yesM)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU06950 (yesM)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU06950 (yesM)
Protein kinases [BR:bsu01001]
 Histidine kinases
  Other
   BSU06950 (yesM)
Two-component system [BR:bsu02022]
 Other families
  YesM-YesN
   BSU06950 (yesM)
SSDB
Motif
Pfam: His_kinase dCache_1 HAMP HATPase_c HATPase_c_2
Other DBs
NCBI-GeneID: 936078
NCBI-ProteinID: NP_388576
Pasteur: BG12847
BSORF: BG12847
UniProt: O31516 A0A6M3Z8M0
Position
758719..760452
AA seq 577 aa
MKKRVAGWYRRMKIKDKLFVFLSLIMAVSFLFVYSGVQYAFHVYDEQIYRKSSEVLRMSS
ERIEDELKKIEDVSYEIITDEQIQRILSMQNRDDTYDQYQMKQELWDQLAGYASDEKYID
SIHVIDARGSEYSAGSSSSDLLQQEQEEVFKRAKAKSGRNLWMTLGGSDPVLISARQIRS
YHQLSLNGLGMVLIQVNVKQMIRDVPKDWGDSVGDIMIADQGGNLVYTAHASAHVPEAAK
ETLKHPGYDLIKKNGKRYFISYLQSSYQNWSYYNVIPFDQMFAKISFMKTVIGTCFLLFF
CVVLLFGRKIANSITEPIEQLVTAMKSVQHSGIEAGVSLSLPEHTQDEAGMLNRHFTVMM
KRINELMEENVEKQLIIKETELKALQAQINPHFLYNTLESINWLAKANQQKQISKMVESL
GFLLRNSIHMKKDIVTIQEEADIVRHYMTIQRFRFEERLKFTLDIDDEVKHCLIPKLTLQ
PLAENAIQYALEPFTRPCAIRIQAKKAKGCVCITVEDNGPGMDGRILESTGGRGIGLWNI
RERISLTFGEPYGLRIHSEHEKGTRIVITIPCRNEVV
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgaagaaaagagttgctggctggtacaggcggatgaagattaaggataagctgtttgtg
tttctatcgttgattatggccgtatcctttctgtttgtatacagcggggtccagtatgcc
tttcatgtgtatgatgagcagatttaccgcaagtcctcggaggtgcttcggatgtcttct
gaaaggatcgaagacgagctgaagaagatagaggatgtgtcatatgaaatcattacagac
gaacagattcagcgcatcctgagcatgcaaaatcgggatgatacgtatgatcaatatcaa
atgaagcaggagctgtgggatcagcttgcgggatatgccagcgatgaaaagtacatcgat
tccattcatgtgattgatgcccgcggctcagagtattcagccggaagcagttcttcagat
cttttgcagcaggagcaggaagaggtatttaagcgagcgaaagcgaaaagtggaagaaat
ctttggatgacgctcggcgggtcagaccccgtcctgatttcagcacggcagatcaggtcc
tatcaccagctgagtctgaacggcttgggcatggtactgatccaggtcaatgtaaaacag
atgattcgtgatgtgccgaaggattggggcgattcagtcggagacattatgattgctgac
caaggcggtaatttggtgtatacggcacatgcatcagcgcatgttcctgaggcagcaaaa
gagacgttgaagcaccccggttatgacttgataaaaaagaatggcaaacgttactttatt
tcttatcttcaatcatcctaccaaaattggagctactataacgttatcccctttgatcag
atgttcgcaaaaatttcctttatgaaaacagtgatcggcacatgctttcttctctttttc
tgtgtggttttgcttttcggaaggaaaatcgccaacagcatcacggagccgattgaacag
cttgtgaccgcgatgaaatcggtacagcacagcggcattgaagcaggtgtgtcgctttct
ctgccggaacatacacaggatgaggccggcatgctgaaccgccattttactgtcatgatg
aaacggattaatgagctgatggaagaaaatgtggaaaaacagctcatcattaaagaaacc
gaattgaaagcactgcaagcccagatcaatccgcattttttatataacacgctcgagtcc
atcaattggctggccaaggcgaatcagcaaaagcaaatctcaaaaatggtggaatcgctc
ggttttcttctgcgaaacagcatacatatgaagaaggatatcgtgaccattcaggaggag
gcggacattgtacgtcactatatgaccattcagcgatttcgatttgaagagcgcctgaaa
ttcacgttggatattgacgatgaggtgaagcattgcctcattccgaaactgacgctccag
ccgcttgcggaaaatgcgattcaatacgcgcttgaaccctttacaaggccatgcgccatc
cggattcaggcgaaaaaggcgaagggctgtgtctgtattacggtcgaagataacggccct
ggcatggatggacggattcttgaatcaacgggtggaagaggaatcggactttggaatatt
cgcgagcgcatcagcctgacattcggagagccatacggattgcggattcatagtgagcat
gaaaaggggacgaggattgtgatcacaataccgtgccgaaatgaggtggtgtga

DBGET integrated database retrieval system