KEGG   Bacillus subtilis subsp. subtilis 168: BSU06960
Entry
BSU06960          CDS       T00010                                 

Symbol
yesN
Name
(RefSeq) transcriptional regulator
  KO
K07720  two-component system, response regulator YesN
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU06960 (yesN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU06960 (yesN)
Two-component system [BR:bsu02022]
 Other families
  YesM-YesN
   BSU06960 (yesN)
SSDB
Motif
Pfam: Response_reg HTH_18 HTH_AraC
Other DBs
NCBI-GeneID: 938764
NCBI-ProteinID: NP_388577
Pasteur: BG12848
BSORF: BG12848
UniProt: O31517 A0A6M3ZDJ4
Position
760452..761558
AA seq 368 aa
MYKILLADDERIILDGMAGIIEWESLGASLIGKAQNGHEAYEKIVHKQPHIVITDVKMPG
MDGLELIKKVSAVSPSVQFIVLSGFGEFEYAKEAMKYGVKHYLLKPCNEQQIISSLEEII
AELKRQDVHKKKTAHLKHELDHIRSFAADQYLEGLIAGVAQLSPPPSLAGKKIRLLILKG
EQSIDAAAREALGSALTAVCSSGEWTVLAVEENAAEKVAEVFADRKMAISQAGELRHAGQ
LFRDTAEASGDLHGSAVISKMIRLIADELGNPNLSLKWAAKDMLFMNPDYLGKLFKQETG
EKFSQYVTRVRLEHAMKQMKIRRDVSVSEIAEEIGFGDNPKYFSLVFKKYTGLTPSEFRR
KQGGASAG
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgtataaaatactgctggctgatgatgagaggattatccttgatggaatggcgggaatc
attgagtgggagtcgcttggcgcctcattgatcggaaaagcgcagaacggacatgaagca
tatgaaaagattgtacataagcagccgcatatcgtcatcacagacgtcaaaatgcccggc
atggacgggcttgagctgatcaaaaaggtgtcagccgtcagcccgtcggtgcaatttatc
gtcctgtccgggtttggagagtttgagtacgcaaaggaagccatgaaatatggggtgaag
cattatttgctgaaaccctgcaatgaacagcagattatcagctcgctggaggaaatcatt
gctgagctgaagcggcaagatgtgcacaaaaagaaaacagcccatctgaaacacgagctg
gaccatatccgttcctttgcagccgatcaatacttggaaggcttgatcgccggtgtggcc
cagctttctccgccgccttcacttgccggaaaaaagatccgcctcttgatcttaaaaggg
gaacaatctattgatgctgcagccagagaggcactcggatcggcactgacagcggtttgc
agcagcggtgaatggaccgtgctcgccgtagaggagaacgccgctgaaaaggtggcggag
gtttttgcggaccgcaagatggccatcagtcaggcgggagaactccggcacgcggggcag
ctgtttcgtgacacagctgaagcgtctggtgacctgcatgggagcgcagtgatttcaaaa
atgatcaggcttattgccgacgagctcggaaatccgaatctgtccttaaaatgggcggcg
aaggatatgctgtttatgaatcctgattatctcgggaagttatttaagcaggaaacaggc
gagaaattttcccaatatgttacacgggtgcgtcttgagcatgcgatgaagcagatgaaa
ataaggagggacgtgagcgtttcagaaattgctgaagaaatcgggtttggcgataatccg
aagtatttcagtcttgtttttaaaaaatataccggtctgacaccgtcagaattcagaaga
aaacagggaggcgcttccgcaggatag

DBGET integrated database retrieval system