KEGG   Bacillus subtilis subsp. subtilis 168: BSU06970
Entry
BSU06970          CDS       T00010                                 

Gene name
yesO
Definition
(RefSeq) ABC transporter substrate-binding protein
  KO
K02027  multiple sugar transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU06970 (yesO)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter
    BSU06970 (yesO)
SSDB
Motif
Pfam: SBP_bac_8 SBP_bac_1 SBP_bac_6
Other DBs
NCBI-GeneID: 936072
NCBI-ProteinID: NP_388578
Pasteur: BG12849
BSORF: BG12849
UniProt: O31518 A0A6M4JGA7
Structure
PDB: 
5Z6B 4R6K 5Z6C

Position
761662..762945
AA seq 427 aa
MKKICYVLLSLVCVFLFSGCSAGEEASGKKEDVTLRIAWWGGQPRHDYTTKVIELYEKKN
PHVHIEAEFANWDDYWKKLAPMSAAGQLPDVIQMDTAYLAQYGKKNQLEDLTPYTKDGTI
DVSSIDENMLSGGKIDNKLYGFTLGVNVLSVIANEDLLKKAGVSINQENWTWEDYEKLAY
DLQEKAGVYGSNGMHPPDIFFPYYLRTKGERFYKEDGTGLAYQDDQLFVDYFERQLRLVK
AKTSPTPDESAQIKGMEDDFIVKGKSAITWNYSNQYLGFARLTDSPLSLYLPPEQMQEKA
LTLKPSMLFSIPKSSEHKKEAAKFINFFVNNEEANQLIKGERGVPVSDKVADAIKPKLNE
EETNIVEYVETASKNISKADPPEPVGSAEVIKLLKDTSDQILYQKVSPEKAAKTFRKKAN
EILERNN
NT seq 1284 nt   +upstreamnt  +downstreamnt
ttgaagaagatttgttacgtgctgttatcccttgtctgcgtctttttgttcagcggatgt
tcagcgggtgaagaggcctcgggaaaaaaagaagatgttacactcagaatcgcgtggtgg
ggcgggcagccaaggcatgattatacaactaaggtaattgaactatacgagaaaaagaat
ccgcacgtccatattgaagcggaatttgcgaactgggatgactactggaaaaagcttgcg
cccatgtctgccgccggccagcttcctgatgtcattcaaatggataccgcttacttagcc
caatacggaaagaagaaccagctggaagatttaacgccgtatacaaaggatggaacgatt
gacgtcagttcaatcgacgagaatatgctgtcgggcggaaaaatcgacaataagctttat
ggatttacgctaggtgtcaacgtgctgtctgtgattgccaatgaagatttgctgaaaaaa
gccggtgtgtctatcaatcaggaaaactggacgtgggaggattacgagaagctggcgtat
gatcttcaggaaaaagccggtgtctacggttccaacggaatgcatccgcctgatattttc
ttcccttattatttgcgcacaaagggtgagcgcttttataaagaagacggcactggcctc
gcgtatcaagatgatcagctgtttgtcgattactttgaacggcagctgaggctagtgaaa
gcgaaaacgtccccaacacctgatgaaagcgcacagattaaagggatggaagacgatttt
atcgtcaaaggcaaatcagcgattacatggaactactccaatcaatatttgggctttgcc
cggctgacagactcgccgctgtctctctatctgccgccggagcaaatgcaggaaaaggcg
ctgacactgaagcccagtatgctgttttccattccgaaaagctctgagcataaaaaagag
gcagcgaaatttattaatttcttcgtgaataatgaggaagcgaaccagctgattaaaggc
gagcgaggcgttccagtctccgacaaggtggcggatgcgattaaaccgaagctgaatgag
gaagaaaccaacatcgtggagtatgtagaaaccgcgtcaaaaaacatcagcaaagccgat
ccgccagagcctgtgggaagcgcggaggtcatcaagctgctgaaagatacgtcagatcag
attctgtatcagaaggtatcgccggaaaaagccgccaaaacgttccggaaaaaggccaat
gagatattagagaggaataattga

DBGET integrated database retrieval system