KEGG   Bacillus subtilis subsp. subtilis 168: BSU06980
Entry
BSU06980          CDS       T00010                                 

Symbol
yesP
Name
(RefSeq) ABC transporter permease
  KO
K02025  multiple sugar transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU06980 (yesP)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter
    BSU06980 (yesP)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 936076
NCBI-ProteinID: NP_388579
Pasteur: BG12850
BSORF: BG12850
UniProt: O31519 A0A6M3Z8P4
Position
762942..763871
AA seq 309 aa
MTGNGADAMKKSRSIRKDNLAGYAFISPFIIGFLCFTVIPMGASLFLSFTSYDLFTAPKW
IGLDNFKEMFTGDEKYWQSLKVTFTYVLAGVPLRLGFALFIAVILNNAAKGTAIYRTLFY
LPSIIGGSVAVAIMWRNIFGNDGVINALLFFVGIDQKILWYQNPTSALWTLILLSVWQFG
SSMLIFLAGLKNIPSSYLEAASVDGANRVQRFFKITLPILTPIIFFNLVMQTISAFMTFT
PAYIISKGEGGPLDGTLLYSLYLFQRAFNYFQMGYASAMAWVMLVIVGLITLILFKTSSY
WVHYESKEE
NT seq 930 nt   +upstreamnt  +downstreamnt
ttgacgggaaatggggctgacgcaatgaaaaaaagccggagtataagaaaagacaatctg
gcgggatatgcttttatttctccgtttatcatcgggttcctatgctttacggtgattccg
atgggggcgtccctgtttctgtccttcacgagctatgacttgtttacggcgccgaaatgg
atcgggctcgacaactttaaggaaatgtttacgggtgacgaaaagtattggcagtctctg
aaggtgacgtttacgtatgtgcttgccggggttccgctccgcctcggcttcgcgcttttt
atcgctgtcattttaaacaatgcagcaaaaggaacggccatttacagaacgctcttttat
ctgccttcgatcatcggcgggagcgtcgccgtggcgattatgtggcgcaatatttttggc
aatgacggggtcatcaatgcgctgctgttttttgtcgggattgatcaaaaaattctttgg
taccagaatccgacaagtgcgctgtggacattgattctgctgtccgtctggcagttcggg
tcgtcaatgctgatttttttggccgggctgaaaaacattccgtcttcgtatttggaagcg
gcaagtgtggatggggcaaatcgggtgcagcgtttcttcaagatcacgcttccgatcctt
acaccgattattttctttaacctagtgatgcagacgatttctgcttttatgacatttaca
cctgcctatatcatttcgaagggcgagggcgggccgcttgacgggacacttctctattcg
ctctatttgttccagcgtgcgtttaactattttcaaatgggctacgcatcggcgatggcg
tgggtcatgcttgtcattgtcgggctgattacgctcatattgtttaaaacatcgtcatat
tgggttcattacgagtcaaaggaggaatga

DBGET integrated database retrieval system