KEGG   Bacillus subtilis subsp. subtilis 168: BSU06990
Entry
BSU06990          CDS       T00010                                 

Symbol
yesQ
Name
(RefSeq) ABC transporter permease
  KO
K02026  multiple sugar transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU06990 (yesQ)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter
    BSU06990 (yesQ)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 938765
NCBI-ProteinID: NP_388580
Pasteur: BG12851
BSORF: BG12851
UniProt: O31520 A0A6M4JFV5
Position
763875..764765
AA seq 296 aa
MEPVNQPVREAPVFERKKAGRVSPKRILFHVFTATLAVLLLYPVIWLFVSSFKESASIFT
TSHSLIPDPFILSNYAEGWKGIAGQPFLTFIKNSAIIVGLSTIGAVMSSAVIAYGFARIP
FKGKKFWFACMMGTLMLPHEVLMIPQYIMFAKLDWLNSFKPIVVPQFFGHAFFIFLMIQF
IRTIPEELDEAARIDGCGRFACFWRIILPLIAPALATSAIFSFYWKWEELIQPLLYLNKP
ELYPVSLALKLFLDTESASNWGAMFAMSAVSLLPVILVFFLFQKYIVQGISTTGLK
NT seq 891 nt   +upstreamnt  +downstreamnt
atggagccggtcaaccagcctgtcagagaagccccggtttttgagagaaaaaaagccggg
cgcgtcagtcccaaacgcatactgttccatgtttttacggcaacgctggcggtgttgctg
ctgtacccggttatttggctgtttgtcagctcgtttaaagaaagcgccagtatttttaca
acctcacattctctcattccagacccttttattctcagtaactatgctgaagggtggaag
ggcattgcgggacagccgtttctgacgtttattaaaaactcggcgattattgtcgggctg
tcaacaatcggtgccgtcatgtcatcggctgtcattgcgtacggatttgcgcgtataccg
tttaagggaaaaaaattttggtttgcgtgcatgatggggacgttaatgctgcctcatgaa
gtgttgatgattccgcagtatattatgtttgcgaaattagactggctgaattcctttaaa
ccaattgtcgttccgcaatttttcgggcatgcgttttttatctttctgatgatccagttt
atccggacgattcccgaggagctggatgaagccgcgcgaatcgacggatgcggacgcttt
gcctgcttttggcggatcattctcccgctgattgcccccgcgcttgcgacgtctgcgatt
ttctccttctattggaagtgggaggagctgattcagccgctcttgtatttgaataagccg
gagctttaccctgtttcacttgcgctgaagctttttctcgatacagagtcggcttcgaac
tggggcgcgatgtttgccatgtcagccgtctcgttattgcctgtgattcttgttttcttt
ttgtttcagaaatatatcgttcagggcatcagtacgaccggattaaaataa

DBGET integrated database retrieval system