KEGG   Bacillus subtilis subsp. subtilis 168: BSU07000
Entry
BSU07000          CDS       T00010                                 

Symbol
yesR
Name
(RefSeq) rhamnogalacturonyl hydrolase
  KO
K15532  unsaturated rhamnogalacturonyl hydrolase [EC:3.2.1.172]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU07000 (yesR)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.172  unsaturated rhamnogalacturonyl hydrolase
     BSU07000 (yesR)
SSDB
Motif
Pfam: Glyco_hydro_88
Other DBs
NCBI-GeneID: 938759
NCBI-ProteinID: NP_388581
Pasteur: BG12852
BSORF: BG12852
UniProt: O31521 A0A6M3Z856
Position
764781..765815
AA seq 344 aa
MAQLIFDEEKVTSVIDRIVKRTFQMDFAWDWPGGVAFYGVAEAYEATENEEYINLLKTWV
DEQLEDGLPPLSINGVSIGHTLLFLHKVTGDDVYLETAAEMAEYVLHKAPRFGEGILQHT
VNAAEYVFPEQAWADTLMMAGLFMLRIGRVMEREDYFEDGLRQFHGHEDVLQDPVTNLYY
HAWDNKAQNHLSGIYWGRANGWAALTMAKALPLIEVTHPSFMIIDGSLRDQLSALVRLQD
ESGLWHTILDDPDSYLEVSASAGIASALMSSGKLYTKYVQKSLAAILDAVEEDGRVSRVS
AGTAVMKNAEGYKQVPYKRIQGWGQGLALTFLADVLKTKKRLYQ
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggcacagcttatctttgatgaagaaaaggtgacgtcggttattgaccggatcgtgaaa
cggacatttcagatggattttgcgtgggattggccgggcggcgttgcgttttacggtgtg
gcggaggcctatgaagcgacggaaaacgaggaatatatcaatctgttaaaaacgtgggtg
gatgaacagctggaggatgggctgccgccgctttcgatcaacggagtttccattgggcat
acgcttttgttcctccacaaggtgacaggtgatgacgtgtatttggaaacagcggccgag
atggcggaatatgtgctgcataaggcgccgcgctttggcgagggtatccttcagcatacg
gtgaatgcggcagaatacgtattccctgaacaggcatgggcggatacgctgatgatggct
gggctgtttatgctgagaatcgggcgggtcatggagcgtgaggattattttgaagacggc
ctgcgccagtttcacggacatgaggatgtgcttcaggaccctgtcacgaatttgtactac
cacgcctgggacaacaaagcgcaaaatcatctgtcggggatttattggggcagggcgaac
ggctgggcggcactcacgatggcaaaggcgctcccgcttattgaggtgacacatccttcc
tttatgatcatcgacggatcgctcagagaccagctgagcgcgcttgtccggcttcaggat
gaatcagggctgtggcatacaattttggatgatccggattcttatctggaggtttcggca
tcagcgggtattgcttctgctctgatgtcgagcggaaagctgtatacaaaatatgtgcag
aaatcgcttgccgccattttggatgcagtggaagaggacggacgggtcagcagggtatcg
gccgggacagccgtcatgaaaaatgccgaaggatacaaacaggtgccttacaaacgaata
caaggatgggggcagggacttgcgctgacgtttcttgctgatgttttgaaaacgaaaaaa
cgcttgtatcagtaa

DBGET integrated database retrieval system