KEGG   Bacillus subtilis subsp. subtilis 168: BSU07010
Entry
BSU07010          CDS       T00010                                 

Symbol
yesS
Name
(RefSeq) AraC family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_18 HTH_AraC dCache_1 5_nucleotid_C
Other DBs
NCBI-GeneID: 936075
NCBI-ProteinID: NP_388582
Pasteur: BG12853
BSORF: BG12853
UniProt: O31522 A0A6M4JE45
Position
765838..768123
AA seq 761 aa
MKKQPQQKERVSRWKGTYFKRNFVFILLIACIPGLLTGGAIYFLSIDKVEKELQRSHETQ
VAREVSRMDEKLGVLELALTQMAYDSSLMNGLAERDLEKDFTFSYQLTKKLFLLRDQQPL
IEQASIFLNSPRPLVLSPEYSALTEQEALRKYRSLLASDHSIYWKRSGNQAMLIQLIPGA
AEKPFGAIMLAVDPKEMESILQSLSPYPDGSALLLDQNREVLFHEGEKDFEKTLLHEIKK
QPAENGHFQMEWKGKVYSVSFGEMNRMHQQWTFVSAAPLSAITAPMVFLSKVIIVMLVIC
IGLAVCMTWYASKKIYRPIQHLLGLFTGGEKKTWQASGQDEFKWIEKRWQDLSLESRKLQ
QQLLRQTPHMKKSFLQHLLQSDFYYDNEESLRFRMEEAGWNIGGNVFHVLDLQVTGLRCE
KSIFREGDEQLAVFTLTNIAEELAAKRVFQLSILDIGRLSVTVLVMKTNSSDLKAYITEL
ARQFGDVTGLCLTSTLSSKTERVTEIPSLFQDVKCGKSRRKFANRDQVIDLQADFPRDEQ
FAPYYPFELEKQIVQTIRLERKQEAKELIDGCMKELSEKAAIDRHVHSALIQLFSRIQED
ILHSGLNPSELFQHRNPFLDISELREPNEAAAWLMDVVVTPYLSKLEGRKNRQQKQLAER
VIAMIHEQYMADISLESCADALGMNSYTLSKAFKQVTGINFIDYVTQIRIEKAKELLVNT
NKKIHDVSEEVGYRHNYFNRIFKKQVGMPPGVFRQMYQETP
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgaaaaaacagcctcaacagaaggaacgggtttctcgctggaagggaacgtatttcaaa
agaaactttgtcttcattttgctgattgcctgtattcccggattgctgactggcggcgca
atctactttctttcgatcgacaaggtggagaaagagctgcagagatcgcatgaaacacag
gtggcgcgtgaggtcagccgaatggatgagaagctgggagtgcttgaactggcactcacc
cagatggcctacgattcttcactgatgaacggattggccgagagggatttggagaaagac
tttacgttctcctatcaattaacgaaaaagctgtttcttttgcgggatcagcagccgctg
atcgagcaggcttccatctttctgaacagcccccggccacttgtgctgagccctgaatac
agcgctttgacagaacaggaggcgcttcgcaagtatcgctcgctgcttgcctcagaccac
agcatttattggaaacggtcgggaaaccaagcgatgctgatccagctcattccgggcgcg
gcggagaaaccgttcggcgcgatcatgctggcggttgatccgaaagaaatggaatcaatc
ctgcaaagcttgtccccctatcctgatggcagtgcgttgcttttagatcaaaatcgagag
gtgctgtttcatgagggggaaaaagattttgaaaagactttacttcatgagataaaaaaa
cagcctgctgagaacggccattttcagatggaatggaaaggcaaggtgtattctgtctcc
tttggagaaatgaaccggatgcatcagcaatggacctttgtgtcagcggcgcctctttca
gctattacagcgccgatggtgtttttatcaaaagtgatcatcgtgatgctggtcatttgc
atcggtttggcggtgtgcatgacatggtatgcatcaaaaaaaatctatcgtcccatccag
catttgcttggcttgtttaccggaggagagaagaaaacatggcaggcgtccgggcaggat
gaattcaaatggattgaaaagagatggcaggatctatcccttgaaagccggaagctccaa
cagcagctcctgcggcagacgccccatatgaaaaagagttttttgcagcatctcttacag
agcgatttttactatgacaacgaggaaagcctcagatttcggatggaggaggctggctgg
aacatcggcggaaacgtgtttcatgtgcttgatctacaggtgacagggctccgctgtgaa
aaaagcatcttccgtgaaggtgatgaacagcttgccgtgtttacactgactaatatcgct
gaggaattggcggctaaacgcgtttttcagctctccatacttgatatcggccggctttct
gtcaccgttcttgtgatgaaaacaaacagctctgatctgaaggcgtatataacggagctg
gcacgccaatttggagatgtaaccggactatgcctgacctcgacattgagcagcaagacg
gagcgtgtcacggaaattccttctttatttcaggatgtgaaatgcggcaaatcccgcagg
aagtttgctaaccgggatcaggtcattgatttgcaggccgacttccctcgggatgagcag
ttcgctccttattacccttttgagctggaaaaacaaattgttcagaccatccggctggaa
agaaaacaggaagccaaggaactgatagatggatgtatgaaggaactgtcggaaaaagcg
gccatagacaggcatgtgcattccgccctgattcagctgttttcccgcattcaggaggat
attttgcattccgggctcaatcccagcgaactgtttcagcaccggaatccgtttcttgat
atttcagaattgcgcgaacctaacgaagcggcggcctggctgatggatgtagtggtgacg
ccttacctttccaagcttgagggcagaaaaaacagacagcaaaagcagctggcagaacgt
gtgattgcgatgattcacgaacagtatatggcggacatttcattggaaagctgtgccgat
gcgcttggcatgaattcctatacgttaagcaaggcatttaagcaagtgaccggcattaat
tttatcgattatgtgacccagatcagaatcgaaaaggcgaaagaactgctggtcaatacg
aataaaaaaattcatgatgtgtctgaagaagtcggctatcgccacaattatttcaatcgg
atttttaaaaaacaggtcggcatgccgccgggtgtcttcaggcaaatgtatcaggaaacg
ccgtga

DBGET integrated database retrieval system